Re: doubt About import machine

Daniel Eduardo Almeida Correa writes: > Hello, I'm trying to use the machine library in python 3.10 version, but I > can't import it with the pip install machine, could you tell me a way to > solve it or a python version compatible with the library? Thank you a lot > for your answer. The "machi

Re: doubt About import machine

On 2021-11-21 18:36, Daniel Eduardo Almeida Correa wrote: Hello, I'm trying to use the machine library in python 3.10 version, but I can't import it with the pip install machine, could you tell me a way to solve it or a python version compatible with the library? Thank you a lot for your answer.

doubt About import machine

Hello, I'm trying to use the machine library in python 3.10 version, but I can't import it with the pip install machine, could you tell me a way to solve it or a python version compatible with the library? Thank you a lot for your answer. -- https://mail.python.org/mailman/listinfo/python-list

Re: Doubt in line_profiler documentation

Abhiram R writes: [...] > https://github.com/rkern/line_profiler > > The definition for the time column says - > > "Time: The total amount of time spent executing the line in the timer's > units. In the header information before the tables, you will see a line > 'Timer unit:' giving the conversio

Doubt in line_profiler documentation

​I'm having trouble understanding something in the ​documentation of https://github.com/rkern/line_profiler The definition for the time column says - "Time: The total amount of time spent executing the line in the timer's units. In the header information before the tables, you will see a line 'Ti

Re: Doubt with files

On Tue, 14 Feb 2017 09:13:48 -0800 (PST), José Manuel Suárez Sierra wrote: > hello, > im trying to read a rtf or txt file with this python script: > > with open(dirFichero,'r') as reader: > for line in reader: > print line > > the problem is that shown is : [suppressing blank lines] >

Re: Doubt with files

On Tue, Feb 14, 2017 at 11:31 AM, Joaquin Alzola wrote: > >>with open(dirFichero,'r') as reader: > > for line in reader: > > print line >> >>the problem is that shown is : >>{\rtf1\ansi\ansicpg1252\cocoartf1504\cocoasubrtf810 >>{\fonttbl\f0\fswiss\fcharset0 Helvetica;} >>{\colortbl;\red2

Re: Doubt with files

On Tue, Feb 14, 2017 at 11:13 AM, José Manuel Suárez Sierra wrote: > hello, > im trying to read a rtf or txt file with this python script: > > with open(dirFichero,'r') as reader: > for line in reader: > print line > > the problem is that shown is : > > {\rtf1\ansi\ansicpg1252\cocoartf

RE: Doubt with files

>with open(dirFichero,'r') as reader: > for line in reader: > print line > >the problem is that shown is : >{\rtf1\ansi\ansicpg1252\cocoartf1504\cocoasubrtf810 >{\fonttbl\f0\fswiss\fcharset0 Helvetica;} >{\colortbl;\red255\green255\blue255;} >{\*\expandedcolortbl;;} >\paperw11900\paperh1

Doubt with files

hello, im trying to read a rtf or txt file with this python script: with open(dirFichero,'r') as reader: for line in reader: print line the problem is that shown is : {\rtf1\ansi\ansicpg1252\cocoartf1504\cocoasubrtf810 {\fonttbl\f0\fswiss\fcharset0 Helvetica;} {\colortbl;\red255\gr

Re: doubt loading pages

José Manuel Suárez Sierra wrote: > El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez > Sierra escribió: >> hello everyone, >> Im trying to make a program that takes an archive from pdb (for instance >> this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY >

Re: doubt loading pages

El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez Sierra escribió: > hello everyone, > Im trying to make a program that takes an archive from pdb (for instance this > link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY > > after reading it I want it to save

Re: doubt loading pages

José Manuel Suárez Sierra wrote: > hello everyone, > Im trying to make a program that takes an archive from pdb (for instance > this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY > > after reading it I want it to save in a list only this part of the > archive: > > MGSSHHS

doubt loading pages

hello everyone, Im trying to make a program that takes an archive from pdb (for instance this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY after reading it I want it to save in a list only this part of the archive: MGSSHHSSGLVPRGSHMASMTGGQQMGRGSMPAETNEYLSRFVEYMTGERKSRYTI

Re: Doubt with matrix

José Manuel Suárez Sierra wrote: > Hello, I want to go over matrix indexs with this code: > def comparador2(a, b): > c3 = ["0"] # variables > x = -1 # contador de letras aniadidas a c3 > i = 0 # contador bucle secuencia a > j = 0 # contador bucle secuencia b > l1 = len(a)

Re: Doubt with matrix

Always Post the entire traceback. That will show us the line of code that raised the error, as well as the sequence of function calls involved. On Jan 12, 2017 11:10 AM, "José Manuel Suárez Sierra" < josemsuarezsie...@gmail.com> wrote: > Hello, I want to go over matrix indexs with this code: > d

Doubt with matrix

Hello, I want to go over matrix indexs with this code: def comparador2(a, b): c3 = ["0"] # variables x = -1 # contador de letras aniadidas a c3 i = 0 # contador bucle secuencia a j = 0 # contador bucle secuencia b l1 = len(a) l2 = len(b) cont = [] # contador de cic

Re: A newbie doubt on methods/functions calling

Honestly, the best implementation strategy I can think of is to first implement a Python interpreter for the actual mainframe environment. Then invent an RPC layer that can semi-transparently bridge the two for when you want to call a module that only exists in the Windows environment (or call _fr

Re: A newbie doubt on methods/functions calling

Let me rephrase my question in other way. class myClass: def __init__(self, var): self.var = var myObj = myClass(abc) # I am calling instance with function name and arguments myObj func1 arg1 arg2 Can i associate any function like __init__ with instance ? Means if I just use in

Re: A newbie doubt on methods/functions calling

On Thu, Oct 6, 2016, at 19:27, Loren Wilton wrote: > So I don't want to WRITE a Python interpreter for the actual mainframe > environment. I want to use an interpreter for an existing environment > (Windows) where there are already a lot of existing libraries. But > since a lot of the data to be an

Re: A newbie doubt on methods/functions calling

Well I jump from TCL to Python. And found that it was very convenient to use Procs there. So I was looking for that luxury in Python. I am not trying to reinvent the wheel. I was just curious to know if there is any possibility to create a caller function in my way (TCL) where I can call pyth

Re: A newbie doubt on methods/functions calling

"Loren Wilton" writes: > strength of Python is that there are many existing 3rd party libraries > that do lots of useful things. Since a lot of them are distributed as > binaries, they would not work in this mainframe environment. Python libraries are usually available as source, either in Python

Re: A newbie doubt on methods/functions calling

Oops, apologies for replying to the wrong thread! Loren -- https://mail.python.org/mailman/listinfo/python-list

Re: A newbie doubt on methods/functions calling

On 06/10/2016 18:06, mr.puneet.go...@gmail.com wrote: Hi I just started learning python. Is there any way to call functions in different way ? Rather calling obj.function(arg1, arg2) I would like to call like below "obj function arg1 arg2" As has been pointed out, it's difficult to tell whe

Re: A newbie doubt on methods/functions calling

[Cue the decades-old story about the elaborate set of C macros that I once saw somebody using so he could write a C program that looked like some flavor of structured BASIC.] I once wrote a set pf C defines so that I could compile Pascal with a C compiler without having to change the Pascal sou

Re: A newbie doubt on methods/functions calling

On 2016-10-06, Steve D'Aprano wrote: > The only way to do this will be to write your own pre-processor, which will > parse your source code, and translate it from your language to valid > Python. That's a lot of work for very little value -- I recommend you just > learn the Python syntax rather t

Re: A newbie doubt on methods/functions calling

On Fri, 7 Oct 2016 04:06 am, mr.puneet.go...@gmail.com wrote: > Hi > > I just started learning python. Is there any way to call functions in > different way ? > > Rather calling obj.function(arg1, arg2) I would like to call like below > > "obj function arg1 arg2" No. This will be a syntax erro

Re: A newbie doubt on methods/functions calling

mr.puneet.go...@gmail.com wrote: > Hi > > I just started learning python. Is there any way to call functions in > different way ? > > Rather calling obj.function(arg1, arg2) I would like to call like below > > "obj function arg1 arg2" How would the machine reading the above know that you didn'

A newbie doubt on methods/functions calling

Hi I just started learning python. Is there any way to call functions in different way ? Rather calling obj.function(arg1, arg2) I would like to call like below "obj function arg1 arg2" this function is part of a class. class myClass: def function(arg1, arg2): # do something

Re: [OT] A doubt about a doubt

Rustom Mody wrote: > I have a doubt: > Is it incorrect to correct someone when they are incorrect? No doubt about it. Everyone's a winner... > [Sprinkle a "politically" on the above to taste ] Ah, contradictio in adiecto. That shifts it to definitely maybe. --

Re: [OT] A doubt about a doubt, was Re: How to XOR a byte output?

On Wednesday, April 13, 2016 at 10:30:07 PM UTC+5:30, Peter Otten wrote: > alister wrote: > > > On Wed, 13 Apr 2016 06:18:22 -0700, durgadevi1 wrote: > > > >> I have a doubt regarding a problem. > >> > > No, you have a question doubt means you don

[OT] A doubt about a doubt, was Re: How to XOR a byte output?

alister wrote: > On Wed, 13 Apr 2016 06:18:22 -0700, durgadevi1 wrote: > >> I have a doubt regarding a problem. >> > No, you have a question doubt means you don't believe something > (sorry I know this is not an English language lesson) "doubt" is common

Re: A newbie's doubt

Às 03:20 de 07-01-2016, Henrique Correa escreveu: > Is Python's Tutorial (by Guido) a good and complete reference for the > language? Good yes. Complete no. I mean, after reading it, should I have a good basis on Python? Yes if you know how to program on another language. > HTH Paulo -- https

Re: A newbie's doubt

That's an awesome response! On Jan 7, 2016 6:35 AM, "Chris Angelico" wrote: > On Thu, Jan 7, 2016 at 2:20 PM, Henrique Correa wrote: > > Is Python's Tutorial (by Guido) a good and complete reference for the > > language? I mean, after reading it, should I have a good basis on Python? > > > > I'v

Re: A newbie's doubt

On Thu, Jan 7, 2016 at 2:20 PM, Henrique Correa wrote: > Is Python's Tutorial (by Guido) a good and complete reference for the > language? I mean, after reading it, should I have a good basis on Python? > > I've came from js and php, and already know the very basics of py. > > Thank you! If by "g

A newbie's doubt

Is Python's Tutorial (by Guido) a good and complete reference for the language? I mean, after reading it, should I have a good basis on Python? I've came from js and php, and already know the very basics of py. Thank you! -- https://mail.python.org/mailman/listinfo/python-list

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-27 20:08, Roy Smith wrote: > > How do you expect people to know they're using a local idiom? > > Look it up in Urban Dictionary and Bob's your uncle. I thought that's how one could tell if it was an *inappropriate* idiom. As a matter of fact, I'm surprised that "Bob's your uncle" does

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

In article , alex23 wrote: > On 27/11/2013 7:12 PM, Antoon Pardon wrote: > > However that there is no perfect solution doesn't imply > > we can't expect some effort from those with english as a mother > > tongue to search for ways in which to express themselves that are > > more likely to be und

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 27/11/2013 7:12 PM, Antoon Pardon wrote: However that there is no perfect solution doesn't imply we can't expect some effort from those with english as a mother tongue to search for ways in which to express themselves that are more likely to be understood by those who had to learn english as a

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wednesday, November 27, 2013 9:55:12 PM UTC+5:30, Tim Chase wrote: > On 2013-11-27 01:32, rusi wrote: > > > And will you be here to explain to time-travelling Shakespeare > > > why we are all of us speaking English completely wrong (to his > > > ears)? > > And to my (Indian!!) ears when Tim sa

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-27 01:32, rusi wrote: > > And will you be here to explain to time-travelling Shakespeare > > why we are all of us speaking English completely wrong (to his > > ears)? > > And to my (Indian!!) ears when Tim says 'plank in the eye' where > King James says 'beam' it does not cut it. Wel

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 11/27/13 8:18 AM, Gene Heskett wrote: On Wednesday 27 November 2013 07:44:18 rusi did opine: On Wednesday, November 27, 2013 7:41:54 AM UTC+5:30, Ned Batchelder wrote: On 11/26/13 8:26 PM, Rick Johnson wrote: And will you be here to explain to time-travelling Shakespeare why we are all

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wed, 27 Nov 2013 09:09:37 -0500, Larry Martell wrote: > On Wed, Nov 27, 2013 at 5:31 AM, Paul Rudin > wrote: >> rusi writes: >> >>> Propositionally: All languages are equal -- Turing complete >> >> As an aside, not all languages are Turing complete. For example Charity >> is a language with t

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wednesday, November 27, 2013 7:39:37 PM UTC+5:30, Larry wrote: > On Wed, Nov 27, 2013 at 5:31 AM, Paul Rudin wrote: > > rusi writes: > >> Propositionally: All languages are equal -- Turing complete > > As an aside, not all languages are Turing complete. For example Charity > > is a language wi

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wed, Nov 27, 2013 at 5:31 AM, Paul Rudin wrote: > rusi writes: > >> Propositionally: All languages are equal -- Turing complete > > As an aside, not all languages are Turing complete. For example Charity > is a language with the property that programs are guaranteed to > terminate. > >

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-27 13:29, rusi wrote: On Wednesday, November 27, 2013 6:27:52 PM UTC+5:30, Robert Kern wrote: On 2013-11-27 08:16, Antoon Pardon wrote: Op 26-11-13 22:42, Tim Delaney schreef: On 27 November 2013 03:57, Antoon Pardon wrote: So I can now ask my questions in dutch and expect ot

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

s the doubt/question distinction. http://www.youtube.com/watch?v=LVzwJ6WWlHA&t=5m06s -- https://mail.python.org/mailman/listinfo/python-list

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wednesday, November 27, 2013 6:27:52 PM UTC+5:30, Robert Kern wrote: > On 2013-11-27 08:16, Antoon Pardon wrote: > > Op 26-11-13 22:42, Tim Delaney schreef: > >> On 27 November 2013 03:57, Antoon Pardon wrote: > >> So I can now ask my questions in dutch and expect others to try and > >>

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wednesday 27 November 2013 07:44:18 rusi did opine: > On Wednesday, November 27, 2013 7:41:54 AM UTC+5:30, Ned Batchelder wrote: > > On 11/26/13 8:26 PM, Rick Johnson wrote: > > > > And will you be here to explain to time-travelling Shakespeare why we > > are all of us speaking English compl

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-27 08:16, Antoon Pardon wrote: Op 26-11-13 22:42, Tim Delaney schreef: On 27 November 2013 03:57, Antoon Pardon mailto:antoon.par...@rece.vub.ac.be>> wrote: So I can now ask my questions in dutch and expect others to try and understand me instead of me asking them in engli

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-27 08:31, Antoon Pardon wrote: Op 27-11-13 09:19, Chris Angelico schreef: On Wed, Nov 27, 2013 at 7:16 PM, Antoon Pardon wrote: However that second sentence doesn't make much sense to me. Modern languages contain a subset that is called the standard language. This is the subset that

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

rusi writes: > Propositionally: All languages are equal -- Turing complete As an aside, not all languages are Turing complete. For example Charity is a language with the property that programs are guaranteed to terminate. -- https

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 11/26/13 11:24 PM, Rick Johnson wrote: On Tuesday, November 26, 2013 8:11:54 PM UTC-6, Ned Batchelder wrote: Rick, through all the verbiage, I've lost track of what you are advocating. The OP asks a question and uses the word doubt in a way that is unusual to you and many other, thoug

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 27/11/2013 08:16, Antoon Pardon wrote: Op 26-11-13 22:42, Tim Delaney schreef: On 27 November 2013 03:57, Antoon Pardon mailto:antoon.par...@rece.vub.ac.be>> wrote: So I can now ask my questions in dutch and expect others to try and understand me instead of me asking them in engli

Re: Completely and utterly Off Topic [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

n. Whereas when somebody says they have a question, we immediately assume that they are not confused, and have no concern at all. [...] Now... *hopefully* we can understand why the words "question" and "doubt" should NEVER be used interchangeably. Now Rick, I know that you're a

Re: Completely and utterly Off Topic [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

On Wed, Nov 27, 2013 at 8:47 PM, rusi wrote: > On Wednesday, November 27, 2013 12:18:11 PM UTC+5:30, Steven D'Aprano wrote: >> On Tue, 26 Nov 2013 17:26:48 -0800, Rick Johnson wrote: > >> [...] >> > "A new home-run record!" > >> What is this "home-run" of which you speak? Houses don't generally r

Re: Still off topic. Deal with it. [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

Steven D'Aprano writes: > On Tue, 26 Nov 2013 20:24:16 -0800, Rick Johnson wrote: > > > Although i would strongly prefer for him to choose ubiquitous > > definitions *over* regional definitions when posting to internet > > forums, i would have happily ignored this thread had it not been > > for S

Re: Completely and utterly Off Topic [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

On Wednesday, November 27, 2013 12:18:11 PM UTC+5:30, Steven D'Aprano wrote: > On Tue, 26 Nov 2013 17:26:48 -0800, Rick Johnson wrote: > [...] > > "A new home-run record!" > What is this "home-run" of which you speak? Houses don't generally run. > Surely you're not using a regional idiom outsid

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wednesday, November 27, 2013 3:02:54 PM UTC+5:30, rusi wrote: [Last line cut-off by mistake!] > It is my impression that the arguments that happen in/around > programming languages are more-heat-less-light than in typical > art/science because artistic questions masquerade as sci

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wednesday, November 27, 2013 7:41:54 AM UTC+5:30, Ned Batchelder wrote: > On 11/26/13 8:26 PM, Rick Johnson wrote: > And will you be here to explain to time-travelling Shakespeare why we > are all of us speaking English completely wrong (to his ears)? And to my (Indian!!) ears when Tim says

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Op 27-11-13 09:36, Chris Angelico schreef: > On Wed, Nov 27, 2013 at 7:31 PM, Antoon Pardon > wrote: >> Op 27-11-13 09:19, Chris Angelico schreef: >>> On Wed, Nov 27, 2013 at 7:16 PM, Antoon Pardon >>> wrote: However that second sentence doesn't make much sense to me. Modern languages c

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wed, Nov 27, 2013 at 7:31 PM, Antoon Pardon wrote: > Op 27-11-13 09:19, Chris Angelico schreef: >> On Wed, Nov 27, 2013 at 7:16 PM, Antoon Pardon >> wrote: >>> However that second sentence doesn't make much sense to me. Modern >>> languages contain a subset that is called the standard language

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Op 27-11-13 09:19, Chris Angelico schreef: > On Wed, Nov 27, 2013 at 7:16 PM, Antoon Pardon > wrote: >> However that second sentence doesn't make much sense to me. Modern >> languages contain a subset that is called the standard language. This >> is the subset that is generally taught. Especially

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wed, Nov 27, 2013 at 7:16 PM, Antoon Pardon wrote: > However that second sentence doesn't make much sense to me. Modern > languages contain a subset that is called the standard language. This > is the subset that is generally taught. Especially to those for whom > the language is foreign. So wh

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Op 26-11-13 22:42, Tim Delaney schreef: > On 27 November 2013 03:57, Antoon Pardon > wrote: > > > So I can now ask my questions in dutch and expect others to try and > understand me instead of me asking them in english? Or can I use > literal tran

Re: Still off topic. Deal with it. [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

On Wed, Nov 27, 2013 at 5:56 PM, Steven D'Aprano wrote: > On Tue, 26 Nov 2013 20:24:16 -0800, Rick Johnson wrote: >> Pop Quiz >> >> Your driving your car down the road when ou

Re: Completely and utterly Off Topic [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

On Wed, Nov 27, 2013 at 5:48 PM, Steven D'Aprano wrote: > I completely sniglim with what you are saying. I'd go further and state > that, without exception, your argument is the most vumtigious I've ever > seen, and if there were any justice in the world, people would follow you > down the street

Still off topic. Deal with it. [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

On Tue, 26 Nov 2013 20:24:16 -0800, Rick Johnson wrote: > Although i would strongly prefer for him to choose ubiquitous > definitions *over* regional definitions when posting to internet forums, > i would have happily ignored this thread had it not been for Stevens > emotional plea of: > > "A

Completely and utterly Off Topic [was Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !]

ll, I suppose that's a step up from calling men twice your age "boy", but not much. > is confused or has some level of concern. Whereas when somebody says they have a question, we immediately assume that they are not confused, and have no concern at all. [...] > Now...

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

ITOUS DEFINITIONS CAN BE NOTHING LESS THAN ILLOGICAL SUICIDE BY EMOTION. Now... *hopefully* we can understand why the words "question" and "doubt" should NEVER be used interchangeably. But for those of you who still seek coddling, read on... ===

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

FROM THEIR UBIQUITOUS DEFINITIONS CAN BE NOTHING LESS THAN ILLOGICAL SUICIDE BY EMOTION. Now... *hopefully* we can understand why the words "question" and "doubt" should NEVER be used interchangeably. But for those of you who still seek coddling, read on...

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 27 November 2013 03:57, Antoon Pardon wrote: > > So I can now ask my questions in dutch and expect others to try and > understand me instead of me asking them in english? Or can I use > literal translations of dutch idioms even if I suspect that such > a literal translation could be misundersto

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Tuesday 26 November 2013 10:49:07 Alister did opine: > On Wed, 27 Nov 2013 01:52:11 +1100, Chris Angelico wrote: > > On Wed, Nov 27, 2013 at 1:37 AM, Roy Smith wrote: > >> We live in an international world (otherwise we wouldn't need that > >> annoying unicode stuff). When you say, "effort to

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Op 26-11-13 15:37, Roy Smith schreef: > In article , > Antoon Pardon wrote: > >> So I think we may expect more effort from the writer in trying to be >> understandable than from the readers in trying to understand. And >> that includes idiom use. > > We live in an international world (otherwi

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wed, 27 Nov 2013 01:52:11 +1100, Chris Angelico wrote: > On Wed, Nov 27, 2013 at 1:37 AM, Roy Smith wrote: >> We live in an international world (otherwise we wouldn't need that >> annoying unicode stuff). When you say, "effort to be understandable", >> what you're really saying is, "everybody

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Wed, Nov 27, 2013 at 1:37 AM, Roy Smith wrote: > We live in an international world (otherwise we wouldn't need that > annoying unicode stuff). When you say, "effort to be understandable", > what you're really saying is, "everybody should be just like me". > > Unfortunately, that's not going to

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

In article , Antoon Pardon wrote: > So I think we may expect more effort from the writer in trying to be > understandable than from the readers in trying to understand. And > that includes idiom use. We live in an international world (otherwise we wouldn't need that annoying unicode stuff).

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 11/25/13 10:33 PM, Rick Johnson wrote:> On Monday, November 25, 2013 2:10:04 PM UTC-6, Ned Batchelder wrote: >> Let's please avoid veering off into rants about language >> and philosophy now. > > Hello Ned. I respect the fact that you want to keep threads > on-topic, and i greatly appreciate t

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

d. >> >> -- >> Antoon Pardon >> -- >> https://mail.python.org/mailman/listinfo/python-list > > > I see the different idioms as kind of interesting, and funny > sometimes, but I don't think they pose a big barrier. IMO that is because the differences in

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Op 25-11-13 21:00, Ethan Furman schreef: > On 11/25/2013 11:53 AM, Antoon Pardon wrote: >> Op 23-11-13 03:18, Steven D'Aprano schreef: >>> >>> As this is an international forum, it behoves us all to make allowances >>> for slight difference in dialect. >> >> I don't see how that follows. I would sa

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Monday, November 25, 2013 2:10:04 PM UTC-6, Ned Batchelder wrote: > Let's please avoid veering off into rants about language > and philosophy now. Hello Ned. I respect the fact that you want to keep threads on-topic, and i greatly appreciate the humbleness of your request. However, i feel as t

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Mon, Nov 25, 2013 at 6:12 PM, Gregory Ewing wrote: > Ned Batchelder wrote: > >> Let's please avoid veering off into rants about language >> > > and philosophy now. > > Philosophy is totally on topic for this group: > > http://www.youtube.com/watch?v=-2gJamguN04 > > A classic! I hadn't seen that

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Ned Batchelder wrote: Let's please avoid veering off into rants about language > and philosophy now. Philosophy is totally on topic for this group: http://www.youtube.com/watch?v=-2gJamguN04 -- Greg -- https://mail.python.org/mailman/listinfo/python-list

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 11/25/2013 11:53 AM, Antoon Pardon wrote: Op 23-11-13 03:18, Steven D'Aprano schreef: As this is an international forum, it behoves us all to make allowances for slight difference in dialect. I don't see how that follows. I would say on the contrary. This being an international forum peopl

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Monday, November 25, 2013 2:32:12 PM UTC-5, Rick Johnson wrote: > On Saturday, November 23, 2013 7:38:47 PM UTC-6, Steven D'Aprano wrote: > > Where do you, an American, > > What the hell makes you believe I'm an American? Because i > speak fluent English? Because i embrace capitalism? Because >

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

>> I'm not an expert on Indian English, but I understand that in that >> dialect it is grammatically correct to say "the codes", just as in UK and >> US English it is grammatically correct to say "the programs". >> >> In other words, in UK/US English, "code" in the sense of programming code >> is a

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Op 23-11-13 03:18, Steven D'Aprano schreef: > On Sat, 23 Nov 2013 01:55:44 +, Denis McMahon wrote: > >> On Fri, 22 Nov 2013 18:22:29 +0530, Bharath Kummar wrote: > >>> Could you PLEASE provide me with the codes (codes only for the asked >>> queries) ? >> >> The codes are: >> >> 1) 7373a28109a

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Saturday, November 23, 2013 7:38:47 PM UTC-6, Steven D'Aprano wrote: > Where do you, an American, What the hell makes you believe I'm an American? Because i speak fluent English? Because i embrace capitalism? Because i wish to be free of tyranny? Well, if that's all it takes to be an American,

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Mon, 25 Nov 2013 16:25:57 +, Grant Edwards wrote: > On 2013-11-23, Dave Angel wrote: > >> Try posting in text, as some of us see nothing in your message. This is >> a text newsgroup, not html. >> >> Also make a subject line that summarizes your issue, not the urgency. > > An exclamation

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-23, Dave Angel wrote: > Try posting in text, as some of us see nothing in your message. This > is a text newsgroup, not html. > > Also make a subject line that summarizes your issue, not the urgency. An exclamation mark is a yellow flag, and three should definitly route a message to

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-23, Steven D'Aprano wrote: > On Sat, 23 Nov 2013 01:55:44 +, Denis McMahon wrote: > >> On Fri, 22 Nov 2013 18:22:29 +0530, Bharath Kummar wrote: > >>> Could you PLEASE provide me with the codes (codes only for the asked >>> queries) ? >> >> The codes are: >> >> 1) 7373a28109a7c447

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Saturday 2013 November 23 23:32, Devin Jeanpierre wrote: > This list needs stronger moderation Rule #1: The ML should not disseminate any message which contains an unquoted "please". -- Yonder nor sorghum stenches shut ladle gulls stopper torque wet strainers. -- https://mail.python.org/m

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Sun, Nov 24, 2013 at 6:32 PM, Devin Jeanpierre wrote: > On Sat, Nov 23, 2013 at 5:38 PM, Steven D'Aprano > wrote: >> Thank you for the lesson in the virtues of bluntness, and why politeness >> and political correctness is a vice. Never let it be said that I'm not >> willing to learn from you R

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Sat, Nov 23, 2013 at 5:38 PM, Steven D'Aprano wrote: > Thank you for the lesson in the virtues of bluntness, and why politeness > and political correctness is a vice. Never let it be said that I'm not > willing to learn from you Rick, so keeping everything you said in mind, > let me say this: >

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Sat, 23 Nov 2013 15:06:42 -0800, Rick Johnson wrote: > On Friday, November 22, 2013 8:18:03 PM UTC-6, Steven D'Aprano wrote: >> As this is an international forum, it behoves us all to make allowances >> for slight difference in dialect. > > I don't thank so. What purpose does that serve? > >

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

Ian Kelly wrote: I wouldn't necessarily even consider it an Indian thing, as I've known Americans to use the same phrase. In my experience it seems to be a scientific community vs. computer science community thing. I often hear Fortran people talk about "a code" where we would say "a library" o

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Fri, Nov 22, 2013 at 8:47 PM, Dennis Lee Bieber wrote: > Rice is the plural of rouse And spice is the plural of spouse. :-) -- Greg -- https://mail.python.org/mailman/listinfo/python-list

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Sun, Nov 24, 2013 at 10:06 AM, Rick Johnson wrote: > On Friday, November 22, 2013 8:18:03 PM UTC-6, Steven D'Aprano wrote: >> As this is an international forum, it behoves us all to make allowances >> for slight difference in dialect. > > I don't thank so. What purpose does that serve? > ... >

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On 2013-11-23 15:06, Rick Johnson wrote: > I don't thank so. What purpose does that serve? > > If we allow people to speak INCORRECT English under the > guise of "political correctness" then no one will benefit. "I don't thank so"? talk about the plank in your own eye... -tkc -- https://mai

Re: Got a Doubt ! Wanting for your Help ! Plz make it ASAP !

On Friday, November 22, 2013 8:18:03 PM UTC-6, Steven D'Aprano wrote: > As this is an international forum, it behoves us all to make allowances > for slight difference in dialect. I don't thank so. What purpose does that serve? If we allow people to speak INCORRECT English under the guise of "po

  1   2   3   4   >