El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez Sierra escribió: > hello everyone, > Im trying to make a program that takes an archive from pdb (for instance this > link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY > > after reading it I want it to save in a list only this part of the archive: > > MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMPAETNEYLSRFVEYMTGERKSRYTIKEYRFLVDQFLSFMNKKPDEITPMDIERYKNFLAVKKRYSKTSQYLAIKAVKLFYKALDLRVPINLTPPKRPSHMPVYLSEDEAKRLIEAASSDTRMYAIVSVLAYTGVRVGELCNLKISDVDLQESIINVRSGKGDKDRIVIMAEECVKALGSYLDLRLSMDTDNDYLFVSNRRVRFDTSTIERMIRDLGKKAGIQKKVTPHVLRHTFATSVLRNGGDIRFIQQILGHASVATTQIYTHLNDSALREMYTQHRPRY > > I have written this: > > import urllib2 > > > seq=raw_input("Introduce pdb code \n") > > > > seq = > urllib2.urlopen("http://www.rcsb.org/pdb/files/fasta.txt?structureIdList="+seq) > print seq.read() > > > seq.close() > > > My question is, how do I save this into a python list? > > Thank you!
What I need is to convert the whole archive into a list, how could I do it? -- https://mail.python.org/mailman/listinfo/python-list
