Hello, I am trying to make a code wich compares between 2 or several sequences
(lists). It compares every element in a list with another list elements. For
example, if we have a list_a=["a","b","c","d"] and list_b=["a","b"] I want to
obtain a new list_c containing elements that match between the
El lunes, 9 de enero de 2017, 14:09:09 (UTC+1), José Manuel Suárez Sierra
escribió:
> Hello, I am trying to make a code wich compares between 2 or several
> sequences (lists). It compares every element in a list with another list
> elements. For example, if we have a list_a=["
El lunes, 9 de enero de 2017, 14:09:09 (UTC+1), José Manuel Suárez Sierra
escribió:
> Hello, I am trying to make a code wich compares between 2 or several
> sequences (lists). It compares every element in a list with another list
> elements. For example, if we have a list_a=["
Hello, I want to go over matrix indexs with this code:
def comparador2(a, b):
c3 = ["0"] # variables
x = -1 # contador de letras aniadidas a c3
i = 0 # contador bucle secuencia a
j = 0 # contador bucle secuencia b
l1 = len(a)
l2 = len(b)
cont = [] # contador de cic
hello everyone,
Im trying to make a program that takes an archive from pdb (for instance this
link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY
after reading it I want it to save in a list only this part of the archive:
MGSSHHSSGLVPRGSHMASMTGGQQMGRGSMPAETNEYLSRFVEYMTGERKSRYTI
El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez Sierra
escribió:
> hello everyone,
> Im trying to make a program that takes an archive from pdb (for instance this
> link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY
>
> after reading it I
hello,
im trying to read a rtf or txt file with this python script:
with open(dirFichero,'r') as reader:
for line in reader:
print line
the problem is that shown is :
{\rtf1\ansi\ansicpg1252\cocoartf1504\cocoasubrtf810
{\fonttbl\f0\fswiss\fcharset0 Helvetica;}
{\colortbl;\red255\gr
Hello,
I am stuck with a (perhaps) easy problem, I hope someone can help me:
My problem is:
I have a list of lists like this one:
[[55, 56, 57, 58, 83, 84, 85, 86, 89, 90, 91, 92, 107, 108, 109, 110, 111, 117,
118, 119, 120, 128, 129, 130, 131, 135, 136, 137, 138, 184, 185, 186, 187, 216,
217, 2