Mark McDuff schrieb:
I'm trying to read one byte from stdin, without the newline.
If I try something like:
>>> import os, sys
>>> os.read(sys.stdin.fileno(),1)
I can input a character, but then I have to press enter, which leaves a
newline character in the stdin buffer and requires two keypr
Richard Simões schrieb:
Hopefully, this explanation will sufficiently clear despite the lack
of code.
I wrote a python script that takes data via stdin, does stuff with the
data, and outputs the result to stdout. A friend wrote a perl script
that opens a pipe to my script, feeds it data, and the
Joshua Kugler wrote:
Experimenting has shown me that re.findall() will return a list with the
matches in the order it found them.
"in the order it found them" doesn't really say much, does it? ;-)
"findall" and "finditer" both scans the string from left to right, and
will return matches in t
patrol wrote:
http://timgolden.me.uk/wmi-project/wmi.py
It cannot work either.
Oh well. It was only a quick fix! I'll try
to get some kind of non-ASCII edition of Windows
to test against. As I understand it, the situation
is that some WMI exception (ie coming from the
underlying WMI/COM subsy
Peter Anderson <[EMAIL PROTECTED]> writes:
> If Python doesn't do it like C and the others then what mechanism does
> it use
You've already been pointed to it, but here it is again:
http://effbot.org/zone/python-objects.htm>
--
\ “I may disagree with what you say, but I will defend to
Bruce Pearson wrote:
The first call to test has the file_list empty but on the second call to
test the file_list is no longer empty but contains the values appended
in the first call.
Is this correct behavior? I'm using python 2.5
yes:
http://docs.python.org/ref/function.html
"Def
ZelluX wrote:
I want to write a script which will rename PDFs according to their
titles. I want to know if there is any library that can extract
titles(the first line of the PDF) from PDFs.
Mathieu Fenniak's PyPdf should be able to do this:
http://pybrary.net/pyPdf/
(but note that "the f
On Jul 16, 2:21 am, Michael Torrie <[EMAIL PROTECTED]> wrote:
> iu2 wrote:
> > I still don't understand: In each recursive call to flatten, acc
> > should be bound to a new [], shouldn't it? Why does the binding happen
> > only on the first call to flatten?
>
> Nope. In each new call it's (re)boun
Hi Vinay,
thank you for being so patient.
On 16 Jul., 01:21, Vinay Sajip <[EMAIL PROTECTED]> wrote:
> On Jul 15, 5:17 pm, McA <[EMAIL PROTECTED]> wrote:
>
> > > If you added the admin sink handler to the root logger, you're done.
>
> > Isn't that the first thing above? What do you mean?
>
> I gav
On Jul 16, 8:34 am, Alia Khouri <[EMAIL PROTECTED]> wrote:
> Here's a very simple snippet I use to automatically keep my versioned
> sources fresh.. Posted here in case it may be of use to anybody...
>
>
> #!/usr/local/bin/python
> import os, sys
>
> src = '/Users/ak/Code/src'
>
> # utility functi
How can i use a variable without define it ?
I have thought about the __import__ function, but the docs says "the
__import__() function does not set the local variable named eggs"。
--
http://mail.python.org/mailman/listinfo/python-list
Dave U. Random <[EMAIL PROTECTED]> wrote:
> http://snipr.com/PracticalDjango
June 2008 is a bit too early. Django isn't ready.
--
Web (en): http://www.no-spoon.de/ -*- Web (de): http://www.frell.de/
--
http://mail.python.org/mailman/listinfo/python-list
On 16 июл, 11:32, Marc 'BlackJack' Rintsch <[EMAIL PROTECTED]> wrote:
> On Tue, 15 Jul 2008 19:54:30 -0700, Yosifov Pavel wrote:
> > Kay, can you show example of such generator? ReIter, for example, work
> > with usual generators.
>
> > But for "big" iterator, I think is no any good solutions. IMHO
zhw <[EMAIL PROTECTED]> writes:
> How can i use a variable without define it ?
What do you mean by "use"? That's so vague I can think of many
possible interpretations.
What do you mean by "variable"? That term carries a lot of baggage
that doesn't apply in Python.
Can you give a small, complete
Mark McDuff wrote:
I'm trying to read one byte from stdin, without the newline.
If I try something like:
>>> import os, sys
>>> os.read(sys.stdin.fileno(),1)
I can input a character, but then I have to press enter, which leaves a
newline character in the stdin buffer and requires two keypre
Terry Reedy wrote:
>Wrong.
Thank you.
>For loop variables continue after the loop exits. This is
>intentional.
I never knew that and I can't find reference to it in the docs. Can you
help me with the reasons for it?
Drea
--
http://mail.python.org/mailman/listinfo/python-list
Stefan Scholl wrote:
Django isn't ready.
That's a remarkably ignorant statement.
--
http://mail.python.org/mailman/listinfo/python-list
On 7月16日, 下午4时47分, Ben Finney <[EMAIL PROTECTED]>
wrote:
> zhw <[EMAIL PROTECTED]> writes:
> > How can i use a variable without define it ?
>
> What do you mean by "use"? That's so vague I can think of many
> possible interpretations.
>
> What do you mean by "variable"? That term carries a lot of b
Alexnb wrote:
e = ''
try:
...
except HTTPError, e:
print e.code
except URLError, e:
print e.reason
if e == '':
print "good to go"
footnote: here's a better way to test if an exception was raised or not:
try:
...
except HTTPError, e:
print e.co
Andreas Tawn wrote:
I never knew that and I can't find reference to it in the docs.
the for-in loop does ordinary assignments in the current scope:
http://docs.python.org/ref/for.html
"Each item in turn is assigned to the target list using the
standard rules for assignments, and
zhw <[EMAIL PROTECTED]> writes:
> Here is a example that I want to complete:
> >>> import sys, new
> >>> context={"name":"david", "sex":"male"}
Here you have a set of values addressible by name.
> >>> sys.modules["foo"] = new.module("foo")
Why do you believe you need to create a module object?
On 7月16日, 下午5时35分, Ben Finney <[EMAIL PROTECTED]>
wrote:
> zhw <[EMAIL PROTECTED]> writes:
> > Here is a example that I want to complete:
> > >>> import sys, new
> > >>> context={"name":"david", "sex":"male"}
>
> Here you have a set of values addressible by name.
>
> > >>> sys.modules["foo"] = new.
On Jul 16, 7:20 am, Mensanator <[EMAIL PROTECTED]> wrote:
> > > ## Combinations with replacement
> > > ## -
> > > ## aaa aab aac aad aae abb abc abd abe acc acd ace
> > > ## add ade aee bbb bbc bbd bbe bcc bcd bce bdd bde
> > > ## bee ccc ccd cce cdd cde cee ddd dde
On 15 Jul, 23:00, Hartmut Goebel <[EMAIL PROTECTED]> wrote:
>
> I started working on cross-pyinstall today.
Let us know how you get on! In theory, one should be able to build
Python (and derived works) using the mingw32 libraries and a suitable
cross-compiler on platforms other than Windows, but I
Hello.
2008/7/16 zhw <[EMAIL PROTECTED]>:
> On 7月16日, 下午5时35分, Ben Finney <[EMAIL PROTECTED]>
> wrote:
>> zhw <[EMAIL PROTECTED]> writes:
>> > Here is a example that I want to complete:
>> > >>> import sys, new
>> > >>> context={"name":"david", "sex":"male"}
>>
>> Here you have a set of values add
On Jul 15, 11:55 pm, Ben Finney <[EMAIL PROTECTED]>
wrote:
> [EMAIL PROTECTED] writes:
> > I just came across this unusual situation where I'd like to modify a
> > string passed to a function
>
> Again: Why? The normal way to do this is to create a new string and
> return that.
>
Yes, usually, bu
Hi Vinay,
> Python uses reference counting with a cycle detector, but the
> detector's behaviour is different if there are finalizers (__del__) -
> see
>
> http://www.python.org/doc/ext/refcounts.html
>
Thank you for the link, that certainly explains a great deal.
So, am I right to assume that
On Jul 16, 11:06 am, zhw <[EMAIL PROTECTED]> wrote:
> On 7月16日, 下午4时47分, Ben Finney <[EMAIL PROTECTED]>
> wrote:
>
>
>
> > zhw <[EMAIL PROTECTED]> writes:
> > > How can i use a variable without define it ?
>
> > What do you mean by "use"? That's so vague I can think of many
> > possible interpretat
Andreas Tawn wrote:
Terry Reedy wrote:
Wrong.
Thank you.
For loop variables continue after the loop exits. This is
intentional.
I never knew that and I can't find reference to it in the docs.
Interesting starting point. It never occurred to me
that they might not. (So I didn't look for an
Guys,
What's the simplest way to access a classes namespace from within itself. I
want to use it in a custom __repr__() method so it prints the current
namespace for the class like package.module.class.
Suggestions? I'm sure there is a simple enough method built in to help me
here, I've jus
Robert Rawlins wrote:
What’s the simplest way to access a classes namespace from within
itself. I want to use it in a custom __repr__() method so it prints the
current namespace for the class like package.module.class.
Name or namespace? You can access the class name from an instance via
th
On Jul 15, 7:21 pm, Michael Torrie <[EMAIL PROTECTED]> wrote:
> iu2 wrote:
> > I still don't understand: In each recursive call to flatten, acc
> > should be bound to a new [], shouldn't it? Why does the binding happen
> > only on the first call to flatten?
>
> Nope. In each new call it's (re)boun
On Jul 16, 1:09 pm, Jeff <[EMAIL PROTECTED]> wrote:
> On Jul 15, 7:21 pm, Michael Torrie <[EMAIL PROTECTED]> wrote:
>
> > iu2 wrote:
> > > I still don't understand: In each recursive call to flatten, acc
> > > should be bound to a new [], shouldn't it? Why does the binding happen
> > > only on the
zhw <[EMAIL PROTECTED]> writes:
> On 7月16日, 下午5时35分, Ben Finney <[EMAIL PROTECTED]>
> wrote:
> > What problem are you trying to solve?
>
> I an sorry, I can't tell you.
Perhaps I'm not being clear: What *programming* problem are you trying
to solve?
I ask because it seems you are focussed to mu
> Andreas Tawn wrote:
> > Terry Reedy wrote:
> >> Wrong.
> > Thank you.
> >
> >> For loop variables continue after the loop exits. This is
> >> intentional.
> > I never knew that and I can't find reference to it in the docs.
>
> Interesting starting point. It never occurred to me
> that they
On 7月16日, 下午3时29分, Tim Golden <[EMAIL PROTECTED]> wrote:
> patrol wrote:
> >>http://timgolden.me.uk/wmi-project/wmi.py
>
> > It cannot work either.
>
> Oh well. It was only a quick fix! I'll try
> to get some kind of non-ASCII edition of Windows
> to test against. As I understand it, the situation
Peter Anderson wrote:
Thanks everyone! Just a quick correction - "as the original poster is"
is a bit of a jump that does not reflect my original question. I DO
understand how C and other programming languages handle variables
internally (the bits of actual memory reserved, etc. etc.) and that
On Jul 13, 8:44 pm, Fuzzyman <[EMAIL PROTECTED]> wrote:
> On Jul 13, 7:56 am, Steven D'Aprano <[EMAIL PROTECTED]
>
>
>
> cybersource.com.au> wrote:
> > On Sat, 12 Jul 2008 19:25:18 -0400, Terry Reedy wrote:
> > > ssecorp wrote:
> > >> def fib(n):
> > >> def fibt(a, b, n):
> > >> if n <=
robnhood00 wrote:
I need a python programmer that can integrate graphics into an
existing python application. The application is a basic application
and the job should be pretty easy for an experienced Python
programmer. Los Angeles programmer is preferred but this can
obviously be done from an
Andreas Tawn wrote:
I don't have experience of too many other languages, but in C++ (and I
guess C)...
That's invalid C (you cannot declare variables in the "for" statement
itself, at least not in C89). And back in the old days, some C++
compilers did in fact leak declarations from "for" lo
Jeff wrote:
Is this avoidable by using a call to list() in the definition instead?
No. Default values are *always* evaluated when, and only when, the
"def" statement is executed; see:
http://docs.python.org/ref/function.html
Also note that "def" is an executable statement in Python, a
Thanks .. but I want to find out if the system is "running on 64bit" even
when the interpreter is a
32-bit build executable ("what python was built on").
platform.architecture() and platform() in general seems to only be looking
at the build executable and what it was built for on windows (sorry, I
Hi guys and girls.
I am currently developing an execution environment for mobile Python
code. To that end I have developed a system called Scavenger based on
Stackless Python. The biggest problem when working with mobile code is
of course security - especially when working with a language such
I save posts from a midi music newsgroup, some are encoded with
yenc encoding. This gave me an opportunity to try out the decoders
in Python. The UU decoder works okay, but my YENC effort gives
results unexpected:
import yenc, sys
fd1=open(sys.argv[1],'r')
#yenc.encode(sys.argv[1],"
On Jul 16, 8:55 am, McA <[EMAIL PROTECTED]> wrote:
> Thank you for that snippet. That means, that the root-logger does
> inherit
> EVERY message (if it fits to the level and isn't filtered) and the
> inheritage chain is build by the chosen logger names, e.g.
> messages tologging.getLogger('tree.lea
Ken Hartling wrote:
> Thanks .. but I want to find out if the system is "running on 64bit"
> even when the interpreter is a 32-bit build executable ("what python
> was built on"). platform.architecture() and platform() in general
> seems to only be looking at the build executable
You can pass i
-Hello all,
I am trying to play stereo wavefiles in python with no success. I can
play mono wavefiles, using either pygames mixer library, python's
winsound library or wxPython's wx.Sound library, but i cannot get
stereo wavefiles to play in any of these. Normally i wouldn't care
and covert the f
Fredrik Lundh wrote:
Ken Hartling wrote:
> Thanks .. but I want to find out if the system is "running on 64bit"
> even when the interpreter is a 32-bit build executable ("what python
> was built on"). platform.architecture() and platform() in general
> seems to only be looking at the build
Tim Golden wrote:
This is included in the latest pywin32-211 as well:
import win32process
print win32process.IsWow64Process ()
on the other hand, "ctypes" is only an import away if you have a current
Python...
--
http://mail.python.org/mailman/listinfo/python-list
Hi all,
How do I write a regular expression for this kind of sequences
>gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
thanks
--
Beema Shafreen
--
http://mail.python.org/mailman/listinfo/python-list
Beema shafreen wrote:
How do I write a regular expression for this kind of sequences
>gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
line.split("|") ?
it's a bit hard to come up with a working RE with only
Although the standard library in Python is great, there are
undoubtedly some great packages available from 3rd parties, and I've
encountered a few almost by accident. However, I don't know how a user
would become aware of many of these. http://pypi.python.org/pypi/
presumably lists most of the dece
On 16 Jul., 15:38, Vinay Sajip <[EMAIL PROTECTED]> wrote:
> On Jul 16, 8:55 am, McA <[EMAIL PROTECTED]> wrote:
>
> > messages tologging.getLogger('tree.leave') would also show up
> > inlogging.getLogger('tree') automatically?
>
> Yes.
Ok.
>
> > Hope not to bother.
>
> Use the propagate flag, whi
Ben Sizer wrote:
make my development a lot easier.
Knowing what kind of development you do might help, of course. Some
libraries are excellent in some contexts and suck badly in others...
Looking at things that larger projects and distributions use can also be
a good idea. For example, i
patrol wrote:
> The errors are in the following:
>
> Traceback (most recent call last):
> File "D:\My Documents\code\python\wmi\test.py", line 5, in
> c = wmi.WMI ("non-existent computer")
> File "C:\Python25\lib\wmi.py", line 1199, in connect
> handle_com_error (error_info)
> File
On Wed, 16 Jul 2008 12:38:50 +0100, Robert Rawlins wrote:
> So, am I right to assume that python will still handle its garbage disposal
> if I implement __del__(), it just handles circular references in a slightly
> different way, but to the same effect. Right?
No. Circular references in objects
Hi all,
I am using someone else's script which expects input in the form of:
./script.py arg2
I was wondering if the angle-brackets here have a special meaning? It
seems like
they specify an input and output stream to use in place of the
console. I could not
find anything in the python man
import sys
class Float(float):
"""
Custom float datatype with addtional attributes.
"""
def __new__(self,
value=0.0, #default value
name='', # string
range=(0.0, 1.0) # tuple
)
On Wed, 16 Jul 2008 07:53:56 -0700, Keith Hughitt wrote:
> I am using someone else's script which expects input in the form of:
>
> ./script.py arg2
>
> I was wondering if the angle-brackets here have a special meaning? It
> seems like they specify an input and output stream to use in plac
Keith Hughitt wrote:
I am using someone else's script which expects input in the form of:
./script.py arg2
is a common notation for "replace with argument value", so it
could be that they're just expecting you to type:
./script.py arg1 arg2
Alternatively, they meant
./scri
Keith Hughitt wrote:
Hi all,
I am using someone else's script which expects input in the form of:
./script.py arg2
I was wondering if the angle-brackets here have a special meaning? It
seems like
they specify an input and output stream to use in place of the
console. I could not
find any
Hi all
I wrote a multithreaded script that polls mails from several pop/imap
accounts. To fetch the messages I'm using the getmail classes (
http://pyropus.ca/software/getmail/ ) , those classes use the poplib for
the real pop transaction.
When I run my script for a few hours cpu usage goes
On Jul 16, 11:16 am, Gary Herron <[EMAIL PROTECTED]> wrote:
> Keith Hughitt wrote:
> > Hi all,
>
> > I am using someone else's script which expects input in the form of:
>
> > ./script.py arg2
>
> > I was wondering if the angle-brackets here have a special meaning? It
> > seems like
> > they
Thanks to all for your time and patience with this!
The insert is working fine based on the suggestions in this thread.
I now have another problem that should be resolved with a regular
expression to remove currency formatting before inserting into the db.
--
http://mail.python.org/mailman/listinf
Hi all,
I'm trying to create a message using SMTP Mail through Python with a
message Importance of either 0 (Low) or 2 (High).
If I do outer.Add_header('Importance', '0') it is ignored.
If I do uter.Replace_header('Importance', '0') I get the error below.
Traceback (most recent call last):
Fil
On 7月16日, 下午10时39分, Tim Golden <[EMAIL PROTECTED]> wrote:
> patrol wrote:
> > The errors are in the following:
>
> > Traceback (most recent call last):
> > File "D:\My Documents\code\python\wmi\test.py", line 5, in
> > c = wmi.WMI ("non-existent computer")
> > File "C:\Python25\lib\wmi.py"
patrol wrote:
> -2147023174
> 'RPC \xb7\xfe\xce\xf1\xc6\xf7\xb2\xbb\xbf\xc9\xd3\xc3\xa1\xa3'
> None
> None
>
> --
> import pythoncom
> import win32com.client
>
>
> try:
> win32com.client.GetObject ("winmgmts://blahblah")
> exc
Hello,
I have an python application which I've been developing for several years (off
and on, mostly off for lack of time) which I'm considering putting up to open
source if I can find other developers interested in contributing.
The application is a web publisher/information outliner. (See an
On Jul 16, 4:14 pm, Fredrik Lundh <[EMAIL PROTECTED]> wrote:
> Beema shafreen wrote:
> > How do I write a regular expression for this kind of sequences
>
> > >gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
> > MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
>
Assuming that the error comes back in the sys.stdout encoding, the following
version *should* work ok. I still haven't got a non-English set up to test it
on, but it certainly does return a Unicode error message.
http://timgolden.me.uk/wmi-project/wmi.py
The usual test case, if you wouldn't min
I have a small project for further development
in eclipse, using the pyDev plug-in.
I am working on foo.py and bar.pyc is also
in the directory.
bar.py is not in the directory; it is someone
else's (confidential) file, and I don't get
the python source.
Can I run bar.pyc from eclipse ?
--
http:
On Jul 15, 10:29 pm, Gary Herron <[EMAIL PROTECTED]> wrote:
> Peng Yu wrote:
> > Hi,
>
> > The following code snippet is from /usr/bin/rpl. I would like the it
> > to match a word, for example, "abc" in ":abc:". But the current one
> > would not match "abc" in ":abc:". I tried to modify it myself.
We're looking at the next phase of development for our webapp, and the
main focus will be to move the core from the app to a web service so
other systems can use the data we've gathered (we're thinking along
the lines of the XML API of Highrise from 37Signals).
Its possible that we'll extend the s
Peng Yu wrote:
I didn't read the docs and tried the following code.
regex = re.compile(r"\A" + re.escape(old_str) + r"\Z",
opts.ignore_case and re.I or 0)
But I'm not sure why it is not working.
as the documentation says, \A and \Z matches at the beginning/end of a
*string*, not a word.
On 7月16日, 下午11时59分, Tim Golden <[EMAIL PROTECTED]> wrote:
> patrol wrote:
> > -2147023174
> > 'RPC \xb7\xfe\xce\xf1\xc6\xf7\xb2\xbb\xbf\xc9\xd3\xc3\xa1\xa3'
> > None
> > None
>
> > --
> > import pythoncom
> > import win32com.client
On 7月17日, 上午12时16分, Tim Golden <[EMAIL PROTECTED]> wrote:
> Assuming that the error comes back in the sys.stdout encoding, the following
> version *should* work ok. I still haven't got a non-English set up to test it
> on, but it certainly does return a Unicode error message.
>
> http://timgolden
Ben Sizer wrote:
I'd love to have some way of finding out what hidden gems are out
there in the Python world
If they were easy to find, they wouldn't be "hidden gems". :-)
Dennis Cote
--
http://mail.python.org/mailman/listinfo/python-list
> > I need to know if I'm running on 32bit or 64bit ... so far I haven't
> > come up with how to get this info via python. sys.platform returns
> > what python was built on ... but not what the current system is.
> >
> > I thought platform.uname() or just platform.processor() would have
> > done
Ty hensons wrote:
> how can i save my command prompt screen?
==
That by itself leaves lots of questions. Taken literally to be the
"box" then:
In Microsoft use the "Print Screen" followed by mspaint and Edit/paste
(Or SHIFT-PrintScreen if whole
On Jul 16, 12:28 pm, norseman <[EMAIL PROTECTED]> wrote:
> Ty hensons wrote:
>
> > how can i save my command prompt screen?
>
> ==
>
> That by itself leaves lots of questions. Taken literally to be the
> "box" then:
>
> In Microsoft use the "Print Scree
This script uses a simple for loop to zip some files. However I am
repeating code that cries out for a nested loop. My two lists of
files_to_be_zipped (spare and seekfacts) are of uneven length so I
can't seem to decipher the "for_logic". I would appreciate any help.
Thanks, Bill
import zipfile
im
patrol wrote:
import wmi
wmi.WMI('non-existent computer')
> Traceback (most recent call last):
> File "", line 1, in
> File "C:\Python25\lib\wmi.py", line 1199, in connect
> handle_com_error (error_info)
> File "C:\Python25\lib\wmi.py", line 184, in handle_com_error
> excep
Hi
Is there any component-oriented (non-MVC) web framework available for
Python?
That is something like Apache Wicket, Tapestry or JSF, but I need it
to be in Python.
Regards,
Ali
--
http://mail.python.org/mailman/listinfo/python-list
Hi All,
Let me start by saying that's I'm relatively new to Python, so please
be gentle!
I need to up upload a file to a Tomcat web app using httplib. The web
app requires the following:
Files need to be split into 100kb (102400b) and each file segment
loaded using the PUT request. It is also a r
On Jul 16, 1:42 pm, [EMAIL PROTECTED] wrote:
> This script uses a simple for loop to zip some files. However I am
> repeating code that cries out for a nested loop. My two lists of
> files_to_be_zipped (spare and seekfacts) are of uneven length so I
> can't seem to decipher the "for_logic". I would
Thanks Gabriel!
That helps clear things up for me. The above method works very well. I
only have one remaining question:
How can I pass a datetime object to MySQL?'
So far, what I've been doing is building the query as a string, for
example:
query = "INSERT INTO image VALUES(%d, %d, %s, '%s')" %
On Jul 16, 6:48 pm, Alis <[EMAIL PROTECTED]> wrote:
> Hi
>
> Is there any component-oriented (non-MVC) web framework available for
> Python?
>
> That is something like Apache Wicket, Tapestry or JSF, but I need it
> to be in Python.
>
> Regards,
> Ali
Have you looked at kamaelia?
http://kamaelia.
On Wed, 16 Jul 2008 15:20:23 +0200, Fredrik Lundh wrote:
[snip]
> Hope this helps more than it confuses.
Absolutely. It is wonderfully enlightening. Many thanks.
--
To email me, substitute nowhere->spamcop, invalid->net.
--
http://mail.python.org/mailman/listinfo/python-list
Fredrik Lundh wrote:
>
> Alexnb wrote:
>
>> e = ''
>
>> try:
>> ...
>> except HTTPError, e:
>> print e.code
>> except URLError, e:
>> print e.reason
>>
>> if e == '':
>> print "good to go"
>
> footnote: here's a better way to test if an exception was raised or not:
>
>
Fredrik Lundh wrote:
> Joshua Kugler wrote:
>
>> Experimenting has shown me that re.findall() will return a list with the
>> matches in the order it found them.
>
> "in the order it found them" doesn't really say much, does it? ;-)
>
> "findall" and "finditer" both scans the string from left to
Hello
I am sure most of you are familiar with py2exe. I am having a bit of a
problem. See the program has a few pictures involved and the .ico it uses
for the windows. However, the pictures are stored in the same directory as
the source, something like: C:\Docs and settings\me\My docs\python\prog
Phillip B Oldham wrote:
> So, can anyone suggest a lightweight python framework which just does
> the essentials?
web.py is pretty slim (not to be confused with web2py).
Pylons isn't very large, depending on what you call "essential."
j
--
http://mail.python.org/mailman/listinfo/python-list
>What we *do* need is a lightweight, simple framework that will allow
>us to create a RESTful interface and throw code together fast. We'll
>probably go with SQLObject (unless we can extract the ORM from django
>- lazy evaluation would be very useful), and we're just looking for
>something fast and
>I don't think RESTful interfaces are built in but I know people have
>succesfully built RESTful apps on top of CherryPy. Also plans >for REST in
>CherryPy 3 look promising. Here is a post I ran across from one of the
>contributers.
>"Hey there,
>CherryPy 3 is currently under brainstorming bef
Hi,
We have a Lotus Notes Database that tracks time spent on projects.
What I would like to do is develop a Time Tracker in Python that
communicates with the server. This would pull projects in and allow a
use to start a timer as he/she works on a given project. The user
would then be able to co
patrol wrote:
> On 7月17日, 上午12时16分, Tim Golden <[EMAIL PROTECTED]> wrote:
>> Assuming that the error comes back in the sys.stdout encoding, the following
>> version *should* work ok. I still haven't got a non-English set up to test
>> it on, but it certainly does return a Unicode error message.
>
On Jul 16, 1:37 pm, Alexnb <[EMAIL PROTECTED]> wrote:
> Hello
>
> I am sure most of you are familiar with py2exe. I am having a bit of a
> problem. See the program has a few pictures involved and the .ico it uses
> for the windows. However, the pictures are stored in the same directory as
> the sou
On Jul 16, 2:11 pm, KDawg44 <[EMAIL PROTECTED]> wrote:
> Hi,
>
> We have a Lotus Notes Database that tracks time spent on projects.
> What I would like to do is develop a Time Tracker in Python that
> communicates with the server. This would pull projects in and allow a
> use to start a timer as h
Mike Driscoll wrote:
>
> On Jul 16, 1:37 pm, Alexnb <[EMAIL PROTECTED]> wrote:
>> Hello
>>
>> I am sure most of you are familiar with py2exe. I am having a bit of a
>> problem. See the program has a few pictures involved and the .ico it uses
>> for the windows. However, the pictures are stored
Alexnb wrote:
>
>
>
> Mike Driscoll wrote:
>>
>> On Jul 16, 1:37 pm, Alexnb <[EMAIL PROTECTED]> wrote:
>>> Hello
>>>
>>> I am sure most of you are familiar with py2exe. I am having a bit of a
>>> problem. See the program has a few pictures involved and the .ico it
>>> uses
>>> for the window
1 - 100 of 150 matches
Mail list logo
