Beema shafreen wrote:
How do I write a regular expression for this kind of sequences
>gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
line.split("|") ?
it's a bit hard to come up with a working RE with only a single sample;
what are the constraints for the different fields? is the last part
free form text or something else, etc.
have you googled for existing implementations of the format you're using?
</F>
--
http://mail.python.org/mailman/listinfo/python-list
