Re: [ccp4bb] [EXTERNAL] [ccp4bb] renaming chains

2021-11-01 Thread Edward A. Berry
I have noticed renaming chains in the sequence ID's but not in the coordinates: 2FBW_3|Chains C, G[auth P]|Succinate dehydrogenase cytoch MATTAKEEMARFWEKNTKSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSL 2FBW_4|Chains D, H[auth Q]|Succinate dehydrogenase [ubiqu GSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSL

Re: [ccp4bb] what would be the best metric to asses the quality of a mtz file?

2021-11-01 Thread James Holton
Hi David, Why not do all those things with Rwork? It is much less noisy than Rfree. Have you ever seen a case in such analysis where Rwork didn't tell you the same thing Rfree did?  If so, did you believe the difference? Once when I was playing with lossy image compression if I picked just t

Re: [ccp4bb] renaming chains

2021-11-01 Thread Oganesyan, Vaheh
Dear John Helliwell, I should have been more clear in addressing my email. It was in response to John Berrisford’s answer. Regards, Vaheh From: John R Helliwell Sent: Monday, November 1, 2021 3:13 PM To: Oganesyan, Vaheh Cc: CCP4BB@jiscmail.ac.uk Subject: Re: [ccp4bb] renaming chains Dear V

Re: [ccp4bb] renaming chains

2021-11-01 Thread John R Helliwell
Dear Valeh Apologies, I was solely replying to the numbering/labelling of waters observation/query of Mohamed, ie as a function of in situ parameter (time, temperature and pressure). Best wishes John Emeritus Professor John R Helliwell DSc > On 1 Nov 2021, at 18:39, Oganesyan, Vaheh > wrot

Re: [ccp4bb] renaming chains

2021-11-01 Thread Oganesyan, Vaheh
Hi John, Thank you for explanation. The most recent encounter I had on this issue was with 3DMM and 3B9K. You would know better what caused chain renaming here, but it doesn't look like any of the two scenarios you describe. Whatever the reason was I'm glad to hear that this is not a widespread

Re: [ccp4bb] (renaming chains)….water numbering aspect

2021-11-01 Thread John R Helliwell
Dear Mohamed, The situation you describe applies also to multiple crystal structures studied as a function not only of time but also of temperatures and pressures. I enquired if the numberings of discussed waters and so on could be retained across the related crystal structures in the PDB. The r

Re: [ccp4bb] renaming chains

2021-11-01 Thread John Berrisford
Dear Vaheh Usually we do not rename chains as part of the curation procedure. There are instances when we do, for example when a chain has to be split into two chains and a new chain has to be defined, but this isn't typical. Because of this the wwPDB mmCIF file for each entry will usually co

Re: [ccp4bb] renaming chains

2021-11-01 Thread Mohamed Ibrahim
Hi All, I have a very similar question; why can't we retain the same water numbering as the deposited files. For articles that discuss waters, it is a considerable challenge. For example, for serial crystallography structures, it becomes confusing and harder for the readers to follow the water num

[ccp4bb] renaming chains

2021-11-01 Thread Oganesyan, Vaheh
Hi All, This question is mostly for RCSB and PDBe: why are you renaming chains in the deposited PDB files? Why does it matter what letter is assigned to the chain? For 1,2 or 3 chain structures it is manageable, but for more chains and/or many complexes per asu this becomes quite a challenge. A

[ccp4bb] Protein crystallographer position available at Sprint Bioscience (Huddinge, Sweden)

2021-11-01 Thread Lionel Trésaugues
Hi, We are recruiting a protein scientist with a passion for protein X-ray crystallography. Apply today if you thrive in an efficient and multi-disciplinary research environment focused on driving innovative drug programs forward. We give you the opportunity to develop both within and outside

Re: [ccp4bb] what would be the best metric to asses the quality of a mtz file?

2021-11-01 Thread David Waterman
Hi James, What you wrote makes lots of sense. I had not heard about Rsleep, so that looks like interesting reading, thanks. I have often used Rfree as a simple tool to compare two protocols. If I am not actually optimising against Rfree but just using it for a one-off comparison then that is okay

Re: [ccp4bb] keyword for refmac to output coordinates in cif format

2021-11-01 Thread John Berrisford
Dear Mark The keyword you want is pdbout format mmcif This is described here: https://www.wwpdb.org/deposition/PDBxDeposit Regards John On 2021-10-30 00:03, Mark J. van Raaij wrote: Dear All, this may be something simple but I can’t find it in the CCP4i GUI or online. Is there a keyword

[ccp4bb] “Crystallographer” and “Crystallography Research Assistant” at Exscientia

2021-11-01 Thread Simone Culurgioni
Dear all, We are expanding our Crystallography team within the Discovery Biology department at Exscientia and we currently have open positions for “Crystallographer” and “Crystallography Research Assistant”. The Discovery Biology team in Exscientia is responsible for enabling small-molecule t