how to duplicate array entries
Hi there, I have an array x=[1,2,3] Is there an operator which I can use to get the result [1,1,1,2,2,2,3,3,3] ? I tried x*3, which resulted in [1,2,3,1,2,3,1,2,3] I also tried [[b,b,b] for b in x] which led to [[1,2,3],[1,2,3], [1,2,3]], but this isn't what I want either. Cheers, Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Re: how to duplicate array entries
On Jan 11, 4:21 pm, Sebastian wrote: > I also tried [[b,b,b] for b in x] which led to [[1,2,3],[1,2,3], > [1,2,3]] Sorry, I have to correct myself. The quoted line above resulted in [[1,1,1],[2,2,2],[3,3,3]] of course! Cheers, Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Re: how to duplicate array entries
Thank you for your answers! I actually implemented it using for loops before I posted here, but I was curious if there is a more elegant solution (judging from the post, Alf will probably say, that for loops are already elegant). Sebastian -- http://mail.python.org/mailman/listinfo/python-list
a is b
I have a question from the pyar list that may have been discussed on this list, but i didn't catch it. Have some common objects been somewhat hardcoded into python, like some integers as shown in the examples below? What other object have been hardcoded (strings ,etc) and what was the criteria used to select them? Any hints? cheers, - Seb >>> p = 500 >>> q = 500 >>> p == q True >>> p is q False >>> n = 50 >>> m = 50 >>> n == m True >>> n is m True >>> p = 500; q = 500 >>> p is q True >>> for i in range(-20,258): ... a = i ... b = i+0 ... if not (a is b): print i ... -20 -19 -18 -17 -16 -15 -14 -13 -12 -11 -10 -9 -8 -7 -6 257 -- http://mail.python.org/mailman/listinfo/python-list
Japanese (speaking) developer needed for a bit of regex magic
Hi all, I'm working on Python bindings for the Amazon Product Advertising API (http://pypi.python.org/pypi/python-amazon-product-api/) which supports the different localised versions - among them a Japanese one (for http://www.amazon.co.jp). All locales return error messages in English. Only the Japanese uses Japanese which my regular expressions cannot handle at the moment. Is there anyone fluent enough in Japanese to give me a hand? The bit of code that needed tweaking can be found here: http://bitbucket.org/basti/python-amazon-product-api/src/tip/amazonproduct.py#cl-152 A simple diff would help me greatly. Thanks for your effort! Seb. P.S. If you have questions, I've set up a mailing list at python- amazon-product-api-de...@googlegroups.com. -- http://mail.python.org/mailman/listinfo/python-list
Re: Japanese (speaking) developer needed for a bit of regex magic
> General advice with character sets in Python apply: always explicitly > declare the encoding of input, then decode to Unicode interally as early > as possible, and process all text that way. Only fix into an encoding > when it's time to output. Maybe I was too vague when describing my problem. As Chris correctly guessed, I have a literal language problem. > > All locales return error messages in English. Only the Japanese uses > > Japanese which my regular expressions cannot handle at the moment. > > What exactly are you expecting to happen, and what exactly happens > instead? My regular expressions turn the Amazon error messages into Python exceptions. This works fine as long as they are in English: "??? is not a valid value for BrowseNodeId. Please change this value and retry your request.", for instance, will raise an InvalidParameterValue exception. However, the Japanese version returns the error message "??? は、BrowseNodeIdの値として無効です。値を変更してから、再度リクエストを実行してください。" which will not be successfully handled. This renders the my module pretty much useless for Japanese users. I'm was therefore wondering if someone with more knowledge of Japanese than me can have a look at my expressions. Maybe the Japanese messages are completely different... I have a collection of sample messages here (all files *-jp-*.xml): http://bitbucket.org/basti/python-amazon-product-api/src/tip/tests/2009-11-01/ Any help is appreciated! Cheers, Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Re: Japanese (speaking) developer needed for a bit of regex magic
> > My regular expressions turn the Amazon error messages into Python > > exceptions. > > > This works fine as long as they are in English: "??? is not a valid > > value for BrowseNodeId. Please change this value and retry your > > request.", for instance, will raise an InvalidParameterValue > > exception. However, the Japanese version returns the error message > > "??? は、BrowseNodeIdの値として無効です。値を変更してから、再度リクエス > > トを実行してください。" which will not be successfully handled. > > > This renders the my module pretty much useless for Japanese users. > > Your problem, then, appears to be that you're attacking the issue at the > wrong layer. Parsing messages in natural language and hoping to > reconstruct a structure is going to be an exercise in frustration. > > Doesn't the API have defined response codes and parameters that you can > use, instead of parsing error strings in various natural languages? No, unfortunately not. If it did, I would have used it. The Amazon API returns an XML response which contains error messages if a request fails. These messages consist of an error code and an error description in natural language. Luckily, the description seems to stick to the same format and is (in all but one case) in plain English. Much to my dismay I discovered that the Japanese locale translates the error message! For example, this is the bit of XML returned for the German locale: AWS.InvalidParameterValue ??? is not a valid value for BrowseNodeId. Please change this value and retry your request. The corresponding part from the Japanese locale looks like this: AWS.InvalidParameterValue ??? は、BrowseNodeIdの値として無効です。値を変更してから、再度リクエストを実行してください。 Of course, one could argue that the type of error (in this case "AWS.InvalidParameterValue") would be enough. However, in order to return a maeningful error message, I would like to parse the description itself - and for this some knowledge of Japanese would be helpful. -- http://mail.python.org/mailman/listinfo/python-list
Re: Japanese (speaking) developer needed for a bit of regex magic
> > This works fine as long as they are in English: > > "??? is not a valid value for BrowseNodeId. > > > Please change this value and retry your request.", > > for instance, will raise an InvalidParameterValue > > > exception. However, the Japanese version returns the error message "??? > > は、BrowseNodeIdの値として無効です。値を変更してから、再度リクエストを実行してください。" > > My daughter, in 2nd year college Japanese, says that the above is > basically a translation of the English boilerplate. The only variable > info is 'BrowserNodeId', which you can read just fine already. > So we do not understand what your problem is and what you want to > accomplish. > > > I have a collection of sample messages here (all files *-jp-*.xml): > >http://bitbucket.org/basti/python-amazon-product-api/src/tip/tests/20... > > Is this a commercial product? Are you willing to pay for serious help, > if needed? > > Terry Jan Reedy I just wanted to know if the Japanese version said the same. I'll probably simply return the error message in full. Any Japanese (speaking) developer will then know what caused the exception. Thanks for your help. -- http://mail.python.org/mailman/listinfo/python-list
Popen question (redundant processes)
Hello World! This is my first post on the list and I'm hoping it is the right forum and not OT, I've searched a bit on this, but, none-the-wiser! My question is on the Popen method, here is my snippet: p1 = Popen(["cat", "georgi_ddr7_allmag_kcor_in_test.dat"], stdout=PIPE ) > p2 = Popen(["fit_coeffs"], stdin=p1.stdout, stdout=PIPE) > p3 = Popen(["reconstruct_maggies"], stdin=p2.stdout,stdout=PIPE) > output_maggies_z=p3.communicate()[0] > > p1 = Popen(["cat", "georgi_ddr7_allmag_kcor_in_test.dat"], stdout=PIPE ) > p2 = Popen(["fit_coeffs"], stdin=p1.stdout, stdout=PIPE) > p4 = Popen(["reconstruct_maggies", "--band-shift", "0.1", "--redshift", > "0."], stdin=p2.stdout,stdout=PIPE) > output_maggies_z0=p4.communicate()[0] > > That is, p1 and p2 are the same, but p3 and p4 which they are passed to, are different. Is there a way to pass p1 and p2 to p3 AND p4 simultaneously, so as to not need to run p1 and p2 twice, as above? What arguments would I need to achieve this? NOTE: "georgi_ddr7_allmag_kcor_in_test.dat" is a very large file (~1E6 records) regards, - Sebastian -- http://mail.python.org/mailman/listinfo/python-list
yield all entries of an iterable
Hi, Is there a simpler way to yield all elements of a sequence than this? for x in xs: yield x I tried googling but fond only the other direction (turning a generator into a list with "list(my_generator())". Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Runtime error
Hi all, I am new to python and I don't know how to fix this error. I only try to execute python (or a cgi script) and I get an ouptu like [...] 'import site' failed; traceback: Traceback (most recent call last): File "/usr/lib/python2.6/site.py", line 513, in main() File "/usr/lib/python2.6/site.py", line 496, in main known_paths = addsitepackages(known_paths) File "/usr/lib/python2.6/site.py", line 288, in addsitepackages addsitedir(sitedir, known_paths) File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line File "", line 1, in File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line File "", line 1, in File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line [...] File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line File "", line 1, in File "/usr/lib/python2.6/site.py", line 175, in addsitedir sitedir, sitedircase = makepath(sitedir) File "/usr/lib/python2.6/site.py", line 76, in makepath dir = os.path.abspath(os.path.join(*paths)) RuntimeError: maximum recursion depth exceeded What is going wrong with my python install? What do I have to change? Thanks, Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Runtime Error
Hi all, I am new to python and I don't know how to fix this error. I only try to execute python (or a cgi script) and I get an ouptu like [...] 'import site' failed; traceback: Traceback (most recent call last): File "/usr/lib/python2.6/site.py", line 513, in main() File "/usr/lib/python2.6/site.py", line 496, in main known_paths = addsitepackages(known_paths) File "/usr/lib/python2.6/site.py", line 288, in addsitepackages addsitedir(sitedir, known_paths) File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line File "", line 1, in File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line File "", line 1, in File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line [...] File "/usr/lib/python2.6/site.py", line 185, in addsitedir addpackage(sitedir, name, known_paths) File "/usr/lib/python2.6/site.py", line 155, in addpackage exec line File "", line 1, in File "/usr/lib/python2.6/site.py", line 175, in addsitedir sitedir, sitedircase = makepath(sitedir) File "/usr/lib/python2.6/site.py", line 76, in makepath dir = os.path.abspath(os.path.join(*paths)) RuntimeError: maximum recursion depth exceeded What is going wrong with my python install? What do I have to change? Thanks, Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Discussion forum for typing Q&A and review requests
Typing with Python is hard and constantly evolving. This is why we set up a forum to help users with typing at https://github.com/python/typing/discussions <https://github.com/python/typing/discussions>. It's fairly new, but at the moment we have two categories for general Q&A and for asking for reviews. If you have questions about typing, please join us there or on our Gitter channel (https://gitter.im/python/typing <https://gitter.im/python/typing>). If you maintain a typing-related package or typing-related documentation, we would be happy if you could add a link to the discussions forum to your documentation. Contributors to the forum and suggestions on how to improve it are most welcome. The forum is intended as a help forum. Discussions about new features, improvements, and implementation should continue to go to the typing-sig list or to the appropriate issue trackers. - Sebastian -- https://mail.python.org/mailman/listinfo/python-list
sharing data across Examples docstrings
Hello,
I am searching for a mechanism for sharing data across Examples sections
in docstrings within a class. For instance:
class Foo:
def foo(self):
"""Method foo title
The example generating data below may be much more laborious.
Examples
>>> x = list("abc") # may be very long and tedious to generate
"""
pass
def bar(self):
"""Method bar title
Examples
>>> # do something else with x from foo Example
"""
pass
Thanks,
--
Seb
--
https://mail.python.org/mailman/listinfo/python-list
Re: sharing data across Examples docstrings
On Wed, 12 Jan 2022 09:28:16 +1100, Cameron Simpson wrote: [...] > Personally I'd be inclined to put long identical examples in the class > docstring instead of the method, but that may not be appropriate. Good point, and perhaps it's best to put a comprehensive example in the class docstring, rather than scatter it across the methods' docstrings. The situation is one in which the methods are typically (but not always) intended to be used as part of a pipeline of operations; e.g. Foo.foo() would almost always be used before Foo.bar(). Thanks, -- Seb -- https://mail.python.org/mailman/listinfo/python-list
A news aggregator for the Python community
Hi! Over the last few weeks I've build a hacker news clone for the Python community: https://news.python.sc The source is at github.com/sebst/pythonic-news I thought that might be of interest to you and I'd be more than happy to hear your thoughts on this. Best, --Sebastian -- https://mail.python.org/mailman/listinfo/python-list
Re: [Info] PEP 308 accepted - new conditional expressions
On 9/30/05, Reinhold Birkenfeld <[EMAIL PROTECTED]> wrote: > after Guido's pronouncement yesterday, in one of the next versions of Python > there will be a conditional expression with the following syntax: > X if C else Y I don't understand why there is a new expression, if this could be accomplished with: if C: X else: Y What is the advantage with the new expression? -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Question about HTMLgen
Hello, I am using HTMLgen. It is very nice. But I can't make it to generate an arbitrary command. For example I want to output this: Each time I put "<" it gets escaped from HTML, instead of being inserted inside. -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: Question about HTMLgen
Thanks, you are right! On 6/20/05, Konstantin Veretennicov <[EMAIL PROTECTED]> wrote: > > > type="image/svg+xml" name="wmap" wmode="transparent"> > > Works for me... -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: python certification
On 16 Jul 2005 09:51:55 -0700, [EMAIL PROTECTED] <[EMAIL PROTECTED]> wrote: > i want to get a small certificate or diploma in python. > it should be online cuz i live in pakistan and wont have teast centers > near me. > it should be low cost as i am not rich. > and hopefully it would be something like a a begginer certification cuz > i am new to python. I could make a program, upload it to sourceforge (or similar OSS repository) and add that to your resume. Another opcion is to help in the development of any python-based program and work enought to be included in the authors list. That could be useful too (because you learn and do some good for more people). I believe more in a working program than a paper based certificate. -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
How to store "3D" data? (data structure question)
Hello, I have to parse a text file (was excel, but I translated to CSV) like the one below, and I am not sure how to store it (to manipulate it later). Here is an extract of the data: Name,Allele,RHA280,RHA801,RHA373,RHA377,HA383 TDF1,181, ,188, ,190, ,193,*,*,,, ,None,,,*,*,* ,, TDF2,1200,*,*,,,* ,None,,,*,*, ,, TDF3,236, ,240, ,244,*,,*,,* ,252,*,*,,, ,None*, ,, Should I use lists? Dictionary? Or a combination? The final goal is to "count" how many stars (*) has any "LINE" (a line is RHA280 for instance). RHA280 has 1 star in TDF1 and 1 star in TDF2 and 2 stars in TDF3. I am lost because I do analize the data "line by line" (for Line in FILE) so it is hard to count by column. -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: How to store "3D" data? (data structure question)
On 20 Jul 2005 10:47:50 -0700, Graham Fawcett <[EMAIL PROTECTED]> wrote: > This looks a lot like 2D data (row/column), not 3D. What's the third > axis? It looks, too, that you're not really interested in storage, but > in analysis... I think it as 3D like this: 1st axis: [MARKER]Name, like TDF1, TDF2. 2nd axis: Allele, like 181, 188 and so on. 3rd axis: Line: RHA280, RHA801. I can have a star in MarkerName TDF1, Allele 181 and Line RHA280. I can have an empty (o none) in TDF1, Allele 181 and Line RHA801. What I like to know is what would be a suitable structure to handle this data? thank you very much! -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: How to store "3D" data? (data structure question)
On 20 Jul 2005 10:47:50 -0700, Graham Fawcett <[EMAIL PROTECTED]> wrote: > # zip is your friend here. It lets you iterate > # across your line names and corresponding values > # in parallel. This zip function is new to me, the only zip I knew was pkzip :). So will read about it. -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: How to store "3D" data? (data structure question)
On 20 Jul 2005 11:51:56 -0700, Graham Fawcett <[EMAIL PROTECTED]> wrote: > You get the idea: model the data in the way that makes it most useable > to you, and/or most efficient (if this is a large data set). I don't think this could be called a large dataset (about 40Kb all the file). It would be an overkill to convert it in MySQL (or any *SQL). I only need to parse it to reformat it. May I send the text file to your email and a sample of the needed output? It seems you understand a lot on this topic and you could do it very easily (I've been all day trying to solve it without success :( I know this is not an usual request, but this would help me a lot and I would learn with your code (I still trying to understand the zip built-in function, that seems useful). -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: How to store "3D" data? (data structure question)
On 7/20/05, Cyril Bazin <[EMAIL PROTECTED]> wrote: > The question of the type of the data sutructure depends of your use of the > data. > You could avoid some confusion without naming your columns "lines"... Yes, that is because they are "plant lines", that is why is called "lines" :) > Anyway, here is a piece of code that read the file and count the star on > the fly: > (The result is a dict of dict of int.) THANK YOU, I will check it out! -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: slicing functionality for strings / Python suitability for bioinformatics
On 19 Sep 2005 12:25:16 -0700, [EMAIL PROTECTED] <[EMAIL PROTECTED]> wrote: > >>> rs='AUGCUAGACGUGGAGUAG' > >>> rs[12:15]='GAG' > Traceback (most recent call last): > File "", line 1, in ? > rs[12:15]='GAG' > TypeError: object doesn't support slice assignment You should try Biopython (www.biopython.org). There is a sequence method you could try. -- http://www.spreadfirefox.com/?q=affiliates&id=24672&t=1";>La web sin popups ni spyware: Usa Firefox en lugar de Internet Explorer -- http://mail.python.org/mailman/listinfo/python-list
Re: debugging during package development
On Sat, 01 Aug 2015 15:30:34 +1000, Ben Finney wrote: > Seb writes: >> With lots of debugging to do, the last thing I'd want is to worry >> about the search path. > Short answer: you need ‘python3 ./setup.py develop’. > Medium-length answer: you need to add some infrastructure to get your > project to the point where you can run ‘python3 ./setup.py develop’. > Longer answer below. >> So I've been searching for better ways to work, but I can't seem hit >> the right keywords and come with all sorts of tangentially related >> stuff. > The Python module search path is an abstraction, with only a partial > relationship to the location of modules files in the filesystem. > The expectation is that a module (or a package of modules) will be > *installed* to a location already in the module search path (with > ‘python ./setup.py . > This allows for cross-platform package management, especially on > systems that don't have a working OS package manager. The trouble is > that it does cause a significant learning curve for Python > programmers, and is an ongoing sore point of Python. >> I'm sure there must be some tool that sets up the development >> environment when the package source is not on `sys.path`. Any advice >> on this topic would be appreciated. > What you need is to tell Distutils which Python modules form your > project https://docs.python.org/3/library/distutils.html>. > Once you've got a working ‘setup.py’ for your project, run ‘python3 > ./setup.py develop’ to allow your packages to be run in-place while > you develop them. This sounds exactly like what I was looking for. I was growing tired of doing 'python setup.py install', every time I wanted to debug something. The subpackages' modules have inter-dependencies, which require the whole package to be in `sys.path`. Unfortunately, I have to stick with Python 2.7... Thank you, -- Seb -- https://mail.python.org/mailman/listinfo/python-list
An "alternative" to Learning Perl
Hello everyone, I was wondering if you could help me. I'm looking for a python introductory book, kind of like Learning Python only smaller (?!) The thing is, I travel to and from work each day for about 1,5h in each direction, and do most of my reading on the train :\ (seriously) And I can't find one (just one) python book shorter than 500 pages that is worth its weight in salt. Anyone know of any, any at all? All suggestions welcomed! -- Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Re: An "alternative" to Learning Perl
On Mon, 9 Jan 2012 00:55:22 -0300, Sean Wolfe wrote: >kindle? ipad? tablet? I'm interested in books, not files ... (seriously, now ... I don't have any of those devices) >also there is python programming for the absolute beginner, which is >agreat book but it's pretty beginner. But well written. At least >Iliked >it.http://www.amazon.com/Python-Programming-Absolute-Beginner-3rd/dp/1435455002 >Also byte of python ... I think there's a hardcover version you can >buyhttp://www.swaroopch.com/buybook/ I think I saw that second one somewhere already. I'll check out the first link, also. Thanks! -- Sebastian -- http://mail.python.org/mailman/listinfo/python-list
Re: To remove some lines from a file
[EMAIL PROTECTED] wrote: > ... I would like to remove two lines from a file. > ... I am quite new myself -- but wouldn't grep -v do that easier (and perhaps faster)? Greetings, Sebastian. -- http://mail.python.org/mailman/listinfo/python-list
Re: To remove some lines from a file
Steve Holden wrote: > Sebastian Busch wrote: >> [EMAIL PROTECTED] wrote: >>> ... I would like to remove two lines from a file. ... >> ... grep -v ... > ... show ... grep -v "`grep -v "commentsymbol" yourfile | head -2`" yourfile i frankly admit that there is also 'head' invoved ;) i really have no idea -- but i always thought that these coreutils and colleagues do their jobs as fast as possible, in particular faster than interpreted languages... however, as i posted last time, i was actually not aware that you have to call three of them. sebastian. -- http://mail.python.org/mailman/listinfo/python-list
Re: To remove some lines from a file
Chetan wrote: > Sebastian Busch <[EMAIL PROTECTED]> writes: > >> Steve Holden wrote: >>> Sebastian Busch wrote: >>>> [EMAIL PROTECTED] wrote: >>>>> ... I would like to remove two lines from a file. ... >>>> ... grep -v ... >>> ... show ... >> grep -v "`grep -v "commentsymbol" yourfile | head -2`" yourfile >> ... > I don't have the original post to know exactly what is needed, but looks like > something that can be done by a single sed script. > > -Chetan Hey! The task is: "Remove the first two lines that don't begin with "@" from a file." Actually, the grep-thing I offered will also delete copies of these two lines that occur in another place. That should be no problem if the file is something like @comment deleteme deleteme @comment data: x-y-dy However, if this is not the case, it cannot be done this way. How would you do it with sed? Best, Sebastian. -- http://mail.python.org/mailman/listinfo/python-list
Timeline for Python?
Hello all, I am working on a Python book, since it could be completed in about a year (writing time + edition + publishing) or more, I would like to know what version to target since I don't want to release a book that will be outdated just after is printed. I use 2.4 for everyday work but most webservers still carry 2.2 (and most programs runs w/o any modification, since I don't tend to use new features), but publishers know that people like to buy lasted version books. So, if the book is published in October 2007, should feature Python 3 or Python 2.5? I did read http://www.python.org/dev/peps/pep-3000/ but I still not sure about timeline. Best regards, SB. -- Bioinformatics news: http://www.bioinformatica.info Lriser: http://www.linspire.com/lraiser_success.php?serial=318 -- http://mail.python.org/mailman/listinfo/python-list
Re: Timeline for Python?
On 1 Sep 2006 00:57:04 -0700, crystalattice <[EMAIL PROTECTED]> wrote: > I'd write for 2.4, even though 2.5 should be coming out "shortly". > There aren't many significant changes to the whole language between 2.4 > and 2.5. Probably the best thing is write for 2.4 and have a sidenote > stating where 2.5 operates differently. > The Python 3 timeline is almost a moving target right now; personally, > I don't think it will be out before next winter. Maybe a beta but I > doubt the full version. Maybe I forgot to tell, but its going to take me at least 6 month to finish the book, then there is a proofreading stage with the publisher and then the release, so it will take about 1 year (about end of 2007), that is why I am thinking in 2.5 and 3. What do you think about it? -- Bioinformatics news: http://www.bioinformatica.info Lriser: http://www.linspire.com/lraiser_success.php?serial=318 -- http://mail.python.org/mailman/listinfo/python-list
Re: windev vs python SOS
stéphane bard wrote: > hello, my boss ask me to prefer windev to python. > I have to argue > > - python work on multiple platform (linux, mac, windows) > A good point but it didn't interest him. Because > we want to choose a language for prototyping. > So multi platform is not enough. > > - python and windev are fast to develop > > - windev as a good IDE, python? boa-constructor is ok with wxpython > > - python is open source (that's not an argument for my boss, sorry > it's a boss ...) > > any idea for a strong argument ? Python is widely known and tested, windev is not. Stuff not widely used (and thus not well verified by Real World(tm)) is a Big Business Risk(tm). Things looking pretty on marketing presentations might show its ugly head in Real Life(tm) where Real Money(tm) is at stake (and in fact they do in vast majority of cases). Python is widely known and has Good Track Record(tm). Windev has not. Python is known to integrate well into Windows. Is your boss really sure that windev is good there? How about various corner cases? Does your boss know about .net? Tell him about IronPython (If Microsoft thinks its good, why your boss should not?). If your boss thinks .net is crap and Java rules, tell him about Jython. It's relatively easy to find (hire) Python programmers. It's not true in case of windev programmers. If your boss needs more people or some people leave (and thus must be replaced), it's a Real Cost(tm) to train new people new windev tricks. Is your boss willing to take the risk that new people will need 1-2 months to get fluent with windev (as he may well forget about hiring trained windev developer in a reasonable amount of time, while hiring trained python developer is possible). rgds -- Sebastian Kaliszewski -- http://mail.python.org/mailman/listinfo/python-list
How to refer to Python?
I am writing a paper where I refer to Python. Is there a paper that I can refer the reader to? Or just use the Python web page as a reference? -- http://mail.python.org/mailman/listinfo/python-list
GNUmed - new version released
Hello, Today we are releasing a new GNUmed version. GNUmed is a package to manage medical offices. Version is up to 0.2.3 Version features and bug fixes are explained in our Wiki http://wiki.gnumed.de/bin/view/Gnumed/ReleaseStatus http://wiki.gnumed.de/bin/view/Gnumed/RoadMap Packages available as usual for GNU/Linux and MS Windows als well as Debian packages MacOSX packages didn't make it yet due to unexplained problems with the Mac port. In general it looks like the code is getting much more stable and easier to fix and extent. Bug reports are appreciated. -- Sebastian Hilbert Leipzig / Germany [www.gnumed.de] -> PGP welcome, HTML ->/dev/null -- http://mail.python.org/mailman/listinfo/python-list
Re: where is python on linux?
Frank Potter wrote: > ... where is the executable python file? ... does whereis python tell you what you want to know? sebastian. -- http://mail.python.org/mailman/listinfo/python-list
en la misma linea
Hola, Aca con una pregunta basica: A veces veo que hay programas que tienen varias instrucciones en la misma linea, cuando lo que aprendi de Python era que se usaba el espaciado para mantener la estructura (indent). Por ejemplo: if name != 'comic': return Hay un return despues de los dos puntos, no se que significa. -- Bioinformatics news: http://www.bioinformatica.info Lriser: http://www.linspire.com/lraiser_success.php?serial=318 -- http://mail.python.org/mailman/listinfo/python-list
Detec nonascii in a string
Hello, How do I detect non-ascii letters in a string? I want to detect the condition that a string have a letter that is not here: string.ascii_letters Best regards, SB. -- Bioinformatics news: http://www.bioinformatica.info Lriser: http://www.linspire.com/lraiser_success.php?serial=318 -- http://mail.python.org/mailman/listinfo/python-list
Re: Detec nonascii in a string
On 2/23/06, Diez B. Roggisch <[EMAIL PROTECTED]> wrote:
> "äöü".decode("ascii")
> should do the trick -- you get an UnicodeError when there is anything ascii
> can't encode.
Thank you. This is good enought for me.
Best regards,
SB.
--
Bioinformatics news: http://www.bioinformatica.info
Lriser: http://www.linspire.com/lraiser_success.php?serial=318
--
http://mail.python.org/mailman/listinfo/python-list
Re: Output of HTML parsing
[ Jackie <[EMAIL PROTECTED]> ]
> 1.The code above assume that each Prof has a tilte. If any one of them
> does not, the name and title will be mismatched. How to program to
> allow that title can be empty?
>
> 2.Is there any easier way to get the data I want other than using
> list?
Use BeautifulSoup.
> 3.Should I close the opened csv file("professor.csv")? How to close
> it?
Assign the file object to a separate name (e.g. stream) and then invoke its
close method after writing all csv data to it.
--
Freedom is always the freedom of dissenters.
(Rosa Luxemburg)
signature.asc
Description: This is a digitally signed message part.
--
http://mail.python.org/mailman/listinfo/python-list
Re: sqlite3 bug??
[ Carsten Haese <[EMAIL PROTECTED]> ] > On Sun, 2007-06-17 at 07:43 -0700, 7stud wrote: > > Please report the whole docs as a bug. > > Calling the entire docs a bug is not helpful. ... unless he also comes up with the "bugfix". ;) -- Freedom is always the freedom of dissenters. (Rosa Luxemburg) signature.asc Description: This is a digitally signed message part. -- http://mail.python.org/mailman/listinfo/python-list
Re: try/except/else/finally problem
[ Ed Jensen <[EMAIL PROTECTED]> ]
> try:
> f = file('test.txt', 'r')
> except IOError:
> print 'except'
> else:
> print 'else'
> finally:
> print 'finally'
>
>
> And the results are:
>
> File "./test.py", line 9
> finally:
> ^
> SyntaxError: invalid syntax
A finally block isn't allowed to appear together with an except block for
releases previous to 2.5. You need to split your exception handling into
two separate blocks.
--
Freedom is always the freedom of dissenters.
(Rosa Luxemburg)
signature.asc
Description: This is a digitally signed message part.
--
http://mail.python.org/mailman/listinfo/python-list
Re: Building a Python app with Mozilla
[ "Diez B. Roggisch" <[EMAIL PROTECTED]> ] > And as it has been said in this thread already, Qt has an excellent free > GUI-builder. Free as long as you develop free software. Development of proprietary, non-gpl software with Qt requires a commercial licence from Trolltech. -- Freedom is always the freedom of dissenters. (Rosa Luxemburg) signature.asc Description: This is a digitally signed message part. -- http://mail.python.org/mailman/listinfo/python-list
Re: linecache and comparison with input
[ Ross Hetherington <[EMAIL PROTECTED]> ]
> #!/usr/bin/env python
>
> import random
> import sys
> import linecache
>
> rnd = random.randint(1,3)
> line = linecache.getline('testfile', rnd)
>
> print line
Try print repr(line) ...
>
> gss = raw_input('Enter line: ',)
and print repr(gss) ;)
> if gss == line:
> print 'yes'
> sys.exit()
> else:
> print 'no'
>
Then you will see, that getline returns the line *including the newline
character*, while raw_input does not. Use line.strip('\n') to remove
trailing newline characters from the return value of getline.
--
Freedom is always the freedom of dissenters.
(Rosa Luxemburg)
signature.asc
Description: This is a digitally signed message part.
--
http://mail.python.org/mailman/listinfo/python-list
Re: Building a Python app with Mozilla
[ "Diez B. Roggisch" <[EMAIL PROTECTED]> ] > > I'd like to build a Python GUI app. Neither Tkinter nor Wxpython nor > > PyQT are actually what I want (because the lack of GUI builders and > > they don't really look good on Windows and Linux). > > The latter statement is bogus. Qt is THE native look on KDE. GTK for > Gnome. So how is it not "looking good on linux"? I guess, "not looking good on linux" refers to Tkinter, which is in fact really ugly on linux systems. > And as it has been said in this thread already, Qt has an excellent free > GUI-builder. So have Gtk and WxWidgets. -- Freedom is always the freedom of dissenters. (Rosa Luxemburg) signature.asc Description: This is a digitally signed message part. -- http://mail.python.org/mailman/listinfo/python-list
Re: The file executing
[ Benjamin <[EMAIL PROTECTED]> ] > On Jul 2, 9:47 pm, Justin Ezequiel <[EMAIL PROTECTED]> > > wrote: > > On Jul 3, 9:40 am, Benjamin <[EMAIL PROTECTED]> wrote: > > > How does one get the path to the file currently executing (not the > > > cwd). Thank you > > > > os.path.dirname(sys.argv[0]) > > The returns the file that was called first, but not the one currently > executing... Use __file__ instead of sys.argv[0] -- Freedom is always the freedom of dissenters. (Rosa Luxemburg) signature.asc Description: This is a digitally signed message part. -- http://mail.python.org/mailman/listinfo/python-list
CSV without first line?
Hi,
In my CSV file, the first line has the name of the variables. So the
data I want to parse resides from line 2 up to the end. Here is what I
do:
import csv
lines=csv.reader(open("MYFILE"))
lines.next() #this is just to avoid the first line
for line in lines:
DATA PARSING
This works fine. But I don't like to do "lines.next()" just to get rid
of the first line. So I wonder if the reader function on the csv
module has something that could let me parse the file from the second
line (w/o doing that lines.next()).
--
Sebastián Bassi (セバスティアン)
Diplomado en Ciencia y Tecnología.
GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D
--
http://mail.python.org/mailman/listinfo/python-list
Re: Can a low-level programmer learn OOP?
On 7/13/07, Simon Hibbs <[EMAIL PROTECTED]> wrote: > place. At the end of it you'll have a good idea how OOP works, and how > Python works. Learning OOp this way is easy and painless, and what you ... But this tutorial states "I assume you know how object-oriented programming works" -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Re: CSV without first line?
On 7/15/07, John Machin <[EMAIL PROTECTED]> wrote: > So you imagine that there is an undocumented feature? No, I just think that is documented but I am not able to understand it. Reading the list I've learned several things that are not directly inferred from documentation (that is not the same as undocumented feature). -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Re: Python CGI and Browser timeout
On 26 Apr 2007 14:48:29 -0700, [EMAIL PROTECTED] <[EMAIL PROTECTED]> wrote: > In order to work around this problem, I started printing empty strings > (i.e. print "") so that the browser does not timeout. How do you print something while doing the query and waiting for the results? I saw some pages that display something like: "This page will be updated in X seconds to show the results" (X is an estimated time depending of server load), after a JS countdown, it refresh itself and show the result or another "This page will be updated in X seconds to show the results". -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D Club de la razón (www.clubdelarazon.org) -- http://mail.python.org/mailman/listinfo/python-list
Re: Python CGI and Browser timeout
On 26 Apr 2007 14:48:29 -0700, [EMAIL PROTECTED] <[EMAIL PROTECTED]> wrote: > Is there a better solution to avoid browser timeouts? Raising timeout in Apache, by default is 300 seconds. Limiting jobs size (both in the html form and from script size since you should not trust on client validations). -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D Club de la razón (www.clubdelarazon.org) -- http://mail.python.org/mailman/listinfo/python-list
Re: SEO - Search Engine Optimization - Seo Consulting
Bob Phillips wrote: > You bottom posters really are a bunch of supercilious, self-righteous > bigots. Whatever. When reading answers to some statements normal people like first to see the statement then the response, not the other way around. Just because you're using broken tool (Outlook Express) it does not excuse you of being rude. Besides, reposting that spamming site address is idiotic by itself, regardless of top posting or not. [...] > And regardless of his response, Mr Bruney IS an MVP, he is clearly > knowledgeable in his subject, and his book is well enough thought of to make > me consider buying it. Regardless of who Mr Bruney is, this if completely offtopic on comp.lang.python, misc.writing, alt.consumers.uk-discounts.and.bargains and uk.people.consumers.ebay Just notice that you're posting to *more than one* group. Just please learn to use the damn reader! Even Outlook Express allows to set Followup-To: header and limit the polution. EOT -- http://mail.python.org/mailman/listinfo/python-list
Re: Writing a nice formatted csv file
On 2 May 2007 07:14:04 -0700, redcic <[EMAIL PROTECTED]> wrote: > And i get an out.txt file looking like: > 1,2,3 > 10,20,30 > Whereas what I'd like to get is: > 1,2,3, > 10, 20, 30 > which is more readable. The idea behind csv module is to produce and read csv files that are "machine readable" rather than "human readable", so I think you should write the file "by hand" to take into account those whitespace. -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D Club de la razón (www.clubdelarazon.org) -- http://mail.python.org/mailman/listinfo/python-list
Re: default config has no md5 module?
On 5/4/07, Leo Jay <[EMAIL PROTECTED]> wrote: > i want to compile a python by myself, but after configure and make, it > seems that md5 is not built by default. > > what should i do to compile md5 as an module? md5 module was deprecated, now it functions are in hashlib. (see http://docs.python.org/lib/module-hashlib.html). So you may not need to compile md5 module at all. -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D Club de la razón (www.clubdelarazon.org) -- http://mail.python.org/mailman/listinfo/python-list
Removing NS in ElementTree
I would like to remove the namespace information from my elements and
have just the tag without this information. This
"{http://uniprot.org/uniprot}"; is preapended into all my output.
I understand that the solution is related with "_namespace_map" but I
don't know much more.
>>> for x in eleroot[0]:
print x.tag
print x.text
{http://uniprot.org/uniprot}accession
Q9JJE1
{http://uniprot.org/uniprot}organism
{http://uniprot.org/uniprot}dbReference
None
{http://uniprot.org/uniprot}sequence
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRL
EAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
LEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGS
LDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILV
--
Sebastián Bassi (セバスティアン)
Diplomado en Ciencia y Tecnología.
GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D
Club de la razón (www.clubdelarazon.org)
--
http://mail.python.org/mailman/listinfo/python-list
expat parser
I have this code:
import xml.parsers.expat
def start_element(name, attrs):
print 'Start element:', name, attrs
def end_element(name):
print 'End element:', name
def char_data(data):
print 'Character data:', repr(data)
p = xml.parsers.expat.ParserCreate()
p.StartElementHandler = start_element
p.EndElementHandler = end_element
p.CharacterDataHandler = char_data
fh=open("/home/sbassi/bioinfo/smallUniprot.xml","r")
p.ParseFile(fh)
And I get this on the output:
...
Start element: sequence {u'checksum': u'E0C0CC2E1F189B8A', u'length': u'393'}
Character data: u'\n'
Character data: u'MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRL'
Character data: u'\n'
Character data: u'EAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH'
...
End element: sequence
...
Is there a way to have the character data together in one string? I
guess it should not be difficult, but I can't do it. Each time the
parse reads a line, return a line, and I want to have it in one
variable.
(the file is here: http://sbassi.googlepages.com/smallUniprot.xml)
--
http://mail.python.org/mailman/listinfo/python-list
Combinatorial of elements in Python?
I have 2 (or more) groups of elements, and I want to get all possible
unique combinations from all of them. Is there a build-in method to do
it?
ADictionary={"one":["A","B","C","D"],"two":["H","I"]}
I want to have all possible combinations from "one" and "two", that is:
AH
BI
CH
DI
AI
BH
CI
DH
Sounds easy, but is not :)
--
Sebastián Bassi (セバスティアン)
Diplomado en Ciencia y Tecnología.
GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D
--
http://mail.python.org/mailman/listinfo/python-list
Re: Combinatorial of elements in Python?
On 8/15/07, Wildemar Wildenburger <[EMAIL PROTECTED]> wrote:
> Oh but it is:
> >>> ADictionary={"one":["A","B","C","D"],"two":["H","I"]}
> >>> result = set()
> >>> for one in ADictionary["one"]:
> ... for two in ADictionary["two"]:
> ... result.add(one + two)
That was easy :)
What about extending it for N elements inside the dictionary? Sounds
like a work for a recursive function.
--
Sebastián Bassi (セバスティアン)
Diplomado en Ciencia y Tecnología.
GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D
--
http://mail.python.org/mailman/listinfo/python-list
Re: Combinatorial of elements in Python?
On 8/15/07, Mikael Olofsson <[EMAIL PROTECTED]> wrote:
> What is unclear here is in what order the keys should be visited. The
> following assumes that the keys should be considered in alphanumeric order.
Yes, my fault. The orden should be given by a string, like:
DCDBA
Using this dictionay.
A={'A':['1','2'],'B':['4','5'],'C':['6','7','8'],'D':['9']}
Should return:
'96941'
'97941'
'97942'
'96942'
'98941'
'98942'
'96951'
'97951'
'97952'
'96952'
'98951'
'98952'
--
Sebastián Bassi (セバスティアン)
Diplomado en Ciencia y Tecnología.
GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D
--
http://mail.python.org/mailman/listinfo/python-list
Re: Python on Computation, Math and Statistics
On 8/19/07, W. Watson <[EMAIL PROTECTED]> wrote: > Google? What's that? Thanks. I like to get a insider's view when I know > experts are out there. So now I ask a deeper question. Are there matrix > computation libraries or even statistical (regression, factor analysis) > libraries? If you are so inclined you can use R functions from Python (look for R and Python in your favorite search engine). -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Re: Biased random?
On 8/27/07, J. Cliff Dyer <[EMAIL PROTECTED]> wrote: > Play with your log to get the range you want Here you can get "true" random numbers (not pseudorandom, they claim to use a quatum generaton (?)) by fetching them from: http://random.irb.hr/ They give you a python class t insert into your code, but you need to register to use it (free). I am not affiliated to them in any way, I just used it once to play with it and it worked. Best, -- Sebastián Bassi (セバスティアン) Diplomado en Ciencia y Tecnología. GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Generating HTML
Hello, What are people using these days to generate HTML? I still use HTMLgen, but I want to know if there are new options. I don't want/need a web-framework a la Zope, just want to produce valid HTML from Python. Best, SB. -- Sebastián Bassi (セバスティアン). Diplomado en Ciencia y Tecnología. Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Box plot in Python
Hello, Is there a graphic package for Python that provides support for box plots? (see http://en.wikipedia.org/wiki/Box_plot and http://en.wikipedia.org/wiki/Image:R-speed_of_light_boxplot.png for information on box plots). I have N sets of data, each with X "points". Example: Set 1: Point 1: 0.21 Point 2: 0.92 Point 3: 0.18 Point 4: 0.12 ... cut Point 203: 0.91 then: Set 2: Point 1: 0.11 Point 2: 0.3 Point 3: 0.82 Point 4: 0.11 ... cut Point 191: 0.09 I know that R would do it, but I don't know how to use R and would like to keep on working in Python. Best, SB. -- http://mail.python.org/mailman/listinfo/python-list
Re: Box plot in Python
On 3/15/07, Rob Clewley <[EMAIL PROTECTED]> wrote: > Matplotlib supports boxplots in a very straightforward fashion and is > reasonably documented (just google it!) I actually just submitted a > patch for extra boxplot features in matplotlib, which you can find on > the sourceforge patch tracker. OK, I will try it. Thanks! -- http://mail.python.org/mailman/listinfo/python-list
Re: How to parse the os.system() output in python
On 17 Mar 2007 17:28:56 -0700, [EMAIL PROTECTED] <[EMAIL PROTECTED]> wrote: > I use os.system() to execute a system command in python. > Can you please tell me how can I parse (in python) the output of the > os.system() ? Maybe you mean to parse the output of the program you run using os.system. If this is the case, you should redirect the putput of the program to a file (with ">") and then parse that file. Best, SB. -- http://mail.python.org/mailman/listinfo/python-list
Re: How to parse the os.system() output in python
On 3/18/07, bruce peng <[EMAIL PROTECTED]> wrote: > how to redirect the putput of the > program to a file? like this: program_name -parameters > outfile.txt -- http://mail.python.org/mailman/listinfo/python-list
Re: Wikipedia and a little piece of Python History
On 21 Mar 2007 12:18:50 -0700, Paddy <[EMAIL PROTECTED]> wrote: > I just had a link to Tim peters first post on doctest: > http://groups.google.com/group/comp.lang.python/msg/1c57cfb7b3772763 AFAIK, Google doesn't offer a permalink to usenet/group post (since a mayor "upgrade" they made some time ago). So this link may change in the future and point to somewhere else. Best, SB. -- http://mail.python.org/mailman/listinfo/python-list
Re: why brackets & commas in func calls can't be ommited? (maybe it could be PEP?)
dmitrey wrote: > if you want > result = func1(func2(arg)) > you should use > result = func1 (func2 arg) This is in conflict with current meanig, Ergo it breaks old code rgds \SK -- http://mail.python.org/mailman/listinfo/python-list
Problem installing Python 2.5
I was trying to install Python 2.5 compiling from sources. I used: ./compile It run OK. Then: make altintall After a lot of output, got this: Listing /usr/local/lib/python2.5/xml/sax ... Compiling /usr/local/lib/python2.5/xml/sax/__init__.py ... Compiling /usr/local/lib/python2.5/xml/sax/_exceptions.py ... Compiling /usr/local/lib/python2.5/xml/sax/expatreader.py ... Compiling /usr/local/lib/python2.5/xml/sax/handler.py ... Compiling /usr/local/lib/python2.5/xml/sax/saxutils.py ... Compiling /usr/local/lib/python2.5/xml/sax/xmlreader.py ... Compiling /usr/local/lib/python2.5/xmllib.py ... Compiling /usr/local/lib/python2.5/xmlrpclib.py ... Compiling /usr/local/lib/python2.5/zipfile.py ... make: *** [libinstall] Error 1 It seems I am not the only one with this error: http://www.thescripts.com/forum/thread613458.html http://www.megasolutions.net/python/Python-installation-problem-(sorry-if-this-is-a-dup)-22624.aspx http://ubuntuforums.org/showthread.php?p=1912370 System: Freespire 1.0.13 (based on Debian). -- http://mail.python.org/mailman/listinfo/python-list
Re: Problem installing Python 2.5
On 4/3/07, Jaroslaw Zabiello <[EMAIL PROTECTED]> wrote: > After executing >./configure > you have to edito >Modules/Setup > file and uncomment the following line: > #zlib zlibmodule.c -I$(prefix)/include -L$(exec_prefix)/lib -lz > Then continue with normal make; make install. Thank you. I already did this: make -i altinstall and then: make altinstall And added a comment in bug#1669349 Best, SB. -- http://mail.python.org/mailman/listinfo/python-list
Re: Python editor/IDE on Linux?
On 4/13/07, Jack <[EMAIL PROTECTED]> wrote: > I wonder what everybody uses for Python editor/IDE on Linux? > I use PyScripter on Windows, which is very good. Not sure if > there's something handy like that on Linux. I need to do some > development work on Linux and the distro I am using is Xubuntu. DrPython is very nice and is already in Ubuntu repos (http://drpython.sourceforge.net/). Eric is also available in Ubuntu (http://www.die-offenbachs.de/detlev/eric.html). -- http://mail.python.org/mailman/listinfo/python-list
Making a tree out of a 2 column list
I have a two column list like: 2,131 6,335 7,6 8,9 10,131 131,99 5,10 And I want to store it in a tree-like structure. So if I request 131, it should return all the child of 131, like 2, 10 and 5 (since 5 is child of 10). If I request 335, it should return: 6 and 7. If I request 9, it should return 8. I guess I could use tuples or dictionaries to do it, but I can't figure out how. Best, SB. -- Sebastián Bassi Diplomado Ciencia y Tecnología. Club de la razón (www.clubdelarazon.org) -- http://mail.python.org/mailman/listinfo/python-list
Re: Making a tree out of a 2 column list
On 14 Apr 2007 09:32:07 -0700, [EMAIL PROTECTED] <[EMAIL PROTECTED]> wrote: > def tree_path(key,tree,indent): > print '\t'*indent,key > if tree.has_key(key): > for m in tree[key]: > tree_path(m,tree,indent+1) > return Thank you. It worked!. I changed it a bit to return a list with the results: def tree_path(key,tree,hijos): hijos.append(key) if tree.has_key(key): for m in tree[key]: tree_path(m,tree,hijos) return hijos Then I call it like this: MyList=tree_path(9608,tree,[]) Best, SB. -- http://mail.python.org/mailman/listinfo/python-list
Re: Making a tree out of a 2 column list
On 4/15/07, Peter Otten <[EMAIL PROTECTED]> wrote:
> Depending on your input data you may need to add some cycle detection.
> For example, try it with
> tree_path(1, {1:[2], 2:[1]}, [])
I guess this should make the program enter into a endless loop. But
the data won't have such a redundancy, because it was taken from a
philogenetic tree.
Best,
SB.
--
http://mail.python.org/mailman/listinfo/python-list
Re: Making a tree out of a 2 column list
On 15 Apr 2007 15:44:47 -0700, [EMAIL PROTECTED] <[EMAIL PROTECTED]> wrote: > But errors and bugs do happen, inside data too; so often it's better > to be on safe side if the safe code is fast enough. Yes, I agree since I've seen lot of errors in data. But this data comes from a taxonomy tree made by the NCBI, that is why I assume the data is right. -- http://mail.python.org/mailman/listinfo/python-list
Re: File DB instead of real database?
On 13 Apr 2007 21:14:36 -0700, Jia Lu <[EMAIL PROTECTED]> wrote: > I donot want to use a real DB like MySQL ... But I need something to > save about more than 1000 articles. > Is there any good ways? SQLite is a good option, as you were told. But what about put them in a dictionary and then cPickle it to disk? (using 2 as optimization setting in cPickle command). -- http://mail.python.org/mailman/listinfo/python-list
Re: Saving parameters between Python applications?
On 9/16/07, Stodge <[EMAIL PROTECTED]> wrote: > python app1.py --location=c:\test1 > What I want to do is save the location parameter, so I can then do (in > the same window): > python app2.py > And have app2.py automatically have access to the value of "location". Do app1.py to save a pickle of the value you want app2 to read. -- Sebastián Bassi (セバスティアン). Diplomado en Ciencia y Tecnología. Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Re: Saving parameters between Python applications?
On 9/17/07, Stodge <[EMAIL PROTECTED]> wrote: > Good idea, but I can't guarantee that the two scripts will be run from > the same directory - so where to store the pickle? It doesn't matter if is the same directory or not, as long as both programs has access to the pickle file (one program should have write access and the other program should have at least read access). -- Sebastián Bassi (セバスティアン). Diplomado en Ciencia y Tecnología. Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Re: Convert string to command..
On 10/18/07, Adam Atlas <[EMAIL PROTECTED]> wrote: > > Use the builtin function "eval". What is the difference with os.system()? -- Sebastián Bassi (セバスティアン). Diplomado en Ciencia y Tecnología. Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Module for SVG?
Hello, I found http://www2.sfk.nl/svg as a Python module for writing SVG. Last update was in 2004 and I am not sure if there is something better. Any recommendation for generating SVG graphics? Best, SB. -- http://mail.python.org/mailman/listinfo/python-list
ANN: A Primer on Python for Life Science Researchers
I'm happy to report the release of a PLOS paper: "A Primer on Python for Life Science Researchers". It is a six page education paper introducing Python. If you have a friend that is a researchers in a biological area and you think that he may need to know Python, please send him this e-mail: URL: http://compbiol.plosjournals.org/perlserv/?request=get-document&doi=10.1371/journal.pcbi.0030199 (short URL: http://tinyurl.com/2az5d5) A Primer on Python for Life Science Researchers Bassi S PLoS Computational Biology Vol. 3, No. 11, e199 doi:10.1371/journal.pcbi.0030199 Thanks, -- Sebastián Bassi -- Sebastián Bassi (セバスティアン). Diplomado en Ciencia y Tecnología. Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
centre of mass of protein
hi all, Is there any script or module in python where we can find the centre of mass of protein? -- http://mail.python.org/mailman/listinfo/python-list
Re: Article of interest: Python pros/cons for the enterprise
Jeff Schwab wrote: >> You like managing your own memory, be my guest. But please don't >> imply that you're putting forth less effort because of it. You're >> just putting forth different effort. > > I disagree with you completely. Your points don't make any sense to me > at all. I believe I am putting forth less effort by having a generic > resource-management infrastructure, rather than a memory-specific > language feature -- that's not just an implication, it's my honest belief. Yet your belief is provably wrong. It's been realised by langauge developers long time ago. It's quite simple. 1. Your "generic" resource-management infrastructure is not generic to begin with! It does not work for mutually dependant resources. 2. Your "generic" infrastructure increases burden on the programmer everywhere any resorce (including trivial one like memory) is used, while GC kills that burden in 95% of the cases. C++ish approach puts the notion of ownership everywhere - both in 95% of cases where it's useless and in remaining 5% where it's actually needed. That's not reduced effort by any means. 3. You can't handle clean-up errors in reasonable way in C++ish approach, so anything more complex should not by handled that way anyway. rgds -- "Never underestimate the power of human stupidity" -- L. Lang -- http://mail.python.org/mailman/listinfo/python-list
Web site for comparing languages syntax
Hello, I know there is one site with wikimedia software installed, that is made for comparing the syntax of several computer languages (Python included). But don't remember the URL. Anyone knows this site? -- Sebastián Bassi (セバスティアン). Diplomado en Ciencia y Tecnología. Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Re: Web site for comparing languages syntax
On 2/26/08, Andreas Tawn <[EMAIL PROTECTED]> wrote: > Maybe http://www.rosettacode.org ? That's a wiki. YES!!!. Thank you!! -- Sebastián Bassi (セバスティアン). Diplomado en Ciencia y Tecnología. Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 GPG Fingerprint: 9470 0980 620D ABFC BE63 A4A4 A3DE C97D 8422 D43D -- http://mail.python.org/mailman/listinfo/python-list
Problem trying to install ReportLab with easy_install
I don't understand what is wrong when I try to install ReportLab. This is under Ubuntu and all build packages are installed. Here is what I get when trying to install it: (I could install it with apt-get, but I am testing virtualenv and easy_install). (testbio149)vi...@maricurie:~/Public/testbio149$ easy_install ReportLab Searching for ReportLab Reading http://pypi.python.org/simple/ReportLab/ Reading http://www.reportlab.com/ Best match: reportLab 2.3 Downloading http://pypi.python.org/packages/source/r/reportlab/reportLab-2.3.zip#md5=7d98b26fa287a9e4be4d35d682ce64ac Processing reportLab-2.3.zip Running ReportLab_2_3/setup.py -q bdist_egg --dist-dir /tmp/easy_install-ZZcgFG/ReportLab_2_3/egg-dist-tmp-FqKULE #Attempting install of _rl_accel, sgmlop & pyHnj #extensions from '/tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel' #Attempting install of _renderPM #extensions from '/tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/renderPM' # installing with freetype version 21 /tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel/_rl_accel.c: In function âhex32â: /tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel/_rl_accel.c:793: warning: format â%8.8Xâ expects type âunsigned intâ, but argument 3 has type âlong unsigned intâ /tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel/_rl_accel.c: In function â_instanceStringWidthUâ: /tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel/_rl_accel.c:1200:warning: pointer targets in assignment differ in signedness /tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel/_rl_accel.c:1123:warning: âfâ may be used uninitialized in this function /tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel/_rl_accel.c:1123:warning: âtâ may be used uninitialized in this function /tmp/easy_install-ZZcgFG/ReportLab_2_3/src/rl_addons/rl_accel/_rl_accel.c:1123:warning: âLâ may be used uninitialized in this function /usr/bin/ld: cannot find -l_renderPM_libart collect2: ld returned 1 exit status error: Setup script exited with error: command 'gcc' failed with exit status 1 (testbio149)vi...@maricurie:~/Public/testbio149$ -- http://mail.python.org/mailman/listinfo/python-list
Re: Problem trying to install ReportLab with easy_install
On Sun, Feb 22, 2009 at 10:07 AM, Garrett Cooper wrote: >It's not building lib_renderPM_libart properly, or it's a typo > that supposed to be librenderPM_libart, or bad LDFLAGS... >More details need to be provided like an ls of your site-packages > directory and a partial ls of your local library directory (ls > /usr/?local/?lib/lib*render*libart*, etc). > sba...@hp:~$ ls /usr/lib/lib*ren* /usr/lib/libktorrent.la/usr/lib/libXrender.la /usr/lib/libktorrent.so/usr/lib/libXrender.so /usr/lib/libktorrent.so.0 /usr/lib/libXrender.so.1 /usr/lib/libktorrent.so.0.0.0 /usr/lib/libXrender.so.1.3.0 /usr/lib/libXrender.a sba...@hp:~$ ls /usr/lib/libart* /usr/lib/libart_lgpl_2.so.2/usr/lib/libartsflow_idl.so.1 /usr/lib/libart_lgpl_2.so.2.3.16 /usr/lib/libartsflow_idl.so.1.0.0 /usr/lib/libart_lgpl.so.2 /usr/lib/libartsflow.so.1 /usr/lib/libart_lgpl.so.2.2.0 /usr/lib/libartsflow.so.1.0.0 /usr/lib/libartscbackend.la/usr/lib/libartsgslplayobject.la /usr/lib/libartscbackend.so.0 /usr/lib/libartsgslplayobject.so.0 /usr/lib/libartscbackend.so.0.0.0 /usr/lib/libartsgslplayobject.so.0.0.0 /usr/lib/libartsc.so.0 /usr/lib/libartskde.so.1 /usr/lib/libartsc.so.0.0.0 /usr/lib/libartskde.so.1.2.0 /usr/lib/libartsdsp.so.0 /usr/lib/libartswavplayobject.la /usr/lib/libartsdsp.so.0.0.0 /usr/lib/libartswavplayobject.so.0 /usr/lib/libartsdsp_st.so.0/usr/lib/libartswavplayobject.so.0.0.0 /usr/lib/libartsdsp_st.so.0.0.0 (t6)sba...@hp:~/test/virtualenv-1.3.2/t6$ ls lib/python2.5/site-packages/ easy-install.pthsetuptools.pth setuptools-0.6c9-py2.5.egg xlwt-0.7.0-py2.5.egg This is a virtualenv created with --no-site-packages (to have a clean start). Other easy_install works, but this one, doesn't :( -- http://mail.python.org/mailman/listinfo/python-list
Re: Python advocacy ... HELP!
Michael_D_G wrote: how do I refute the notion that Python is a "marginal" language because according to TOBIE it only less than a 6% market share. According to the same TIOBE, C++ has less than 11%. So it must be niche then as well :) -- "Never underestimate the power of human stupidity" -- L. Lang -- http://www.tajga.org -- (some photos from my travels) -- http://mail.python.org/mailman/listinfo/python-list
Re: How to find the beginning of last line of a big text file ?
On Thu, Jan 1, 2009 at 2:19 PM, Barak, Ron wrote: > I have a very big text file: I need to find the place where the last line > begins (namely, the offset of the one-before-the-last '\n' + 1). > Could you suggest a way to do that without getting all the file into memory > (as I said, it's a big file), or heaving to readline() all lines (ditto) ? for line in open(filename): lastline = line print "the lastline is: %s",%lastline This will read all the lines, but line by line, so you will never have the whole file in memory. There may be more eficient ways to do this, like using the itertools. Best, SB. -- http://mail.python.org/mailman/listinfo/python-list
Re: How to store passwords?
On Wed, Jan 7, 2009 at 6:42 PM, Oltmans wrote: > I'm writing a program in which I will ask users to enter user name and > password once only. It's a console based program that will run on In general you don't store the password, but a "hash" of it. Then when the user logs-in, you hash it and compare the result with the stored hash. About hash, use sha, look here: http://docs.python.org/library/hashlib.html#module-hashlib > Windows XP. Actually, I'm trying to provide the similar functionality > as "Remember me" thing in browsers. For that, I will need to store > user name and passwords on the disk. I don't have a background in I don't understand how this is supposed to work. "Remember me" in browser doesn't store passwords. > using? Moreover, I cannot use a whole library to do that due to > certain issues. However, I can use like 1--2 files that will be > shipped along with the main script. Any ideas? Any help will be really > appreciated. Thanks. The library I pointed out before is built-in. Best, SB. -- Sebastián Bassi. Diplomado en Ciencia y Tecnología. Book: Python for bioinformatics. http://tinyurl.com/biopython Vendo isla: http://www.genesdigitales.com/isla What's new in Python 3: http://tinyurl.com/5cd89r Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 -- http://mail.python.org/mailman/listinfo/python-list
Re: Emacs users: feedback on diffs between python-mode.el and python.el?
At Thu, 16 Oct 2008 18:21:38 +0200 wrote Bruno Desthuilliers <[EMAIL PROTECTED]>: >> It doesn't look like there's >> any way to browse the subversion any more, though. > > Doh :( > > Is there any way to get this version then ??? svn co https://python-mode.svn.sourceforge.net/svnroot/python-mode/trunk/ python-mode -- Freedom is always the freedom of dissenters. (Rosa Luxemburg) -- http://mail.python.org/mailman/listinfo/python-list
Re: Commercial Products in Python
On Tue, Oct 21, 2008 at 2:50 PM, Paulo J. Matos <[EMAIL PROTECTED]> wrote: > I was just wondering, if you wish to commercialize an application > developed in Python, what's the way to go? You choose the conditions. Nothing in Python license prevents you of selling your work. > I guess the only way is to sell the source, right? No > This is because (and tell me if I am wrong): > 1) You can't sell an executable because Python doesn't compile to native > code (the usual approach, afaik); There are py2exe utilities to compile Python applications. > 2) You can't sell the bytecode, otherwise you get the client stuck with > a specific python version (given bytecode might vary between versions) > (the alternative); Never heard of people selling bytecode, but I guess yes, it is tied to the same version where is was produced. -- Sebastián Bassi. Diplomado en Ciencia y Tecnología. Vendo isla: http://www.genesdigitales.com/isla What's new in Python 3: http://tinyurl.com/5cd89r Curso Biologia molecular para programadores: http://tinyurl.com/2vv8w6 -- http://mail.python.org/mailman/listinfo/python-list
IDLE home page?
If I put IDLE in the search box at python.org, the first hit is: http://www.python.org/idle/ But this page is a directory without any index file: Index of /idle Icon NameLast modified Size Description[DIR] Parent Directory - [ ] Makefile26-Aug-2005 10:30 90 [DIR] doc/26-Aug-2005 10:30- [TXT] links.h 26-Aug-2005 10:30 235 If I see the "ABOUT" windows (under HELP in the IDLE menu), there is also a link to http://www.python.org/idle/ (see here: http://imagebin.ca/view/0OE3jc.html) So the question is: Is there an official page for IDLE or a file is missing? -- http://mail.python.org/mailman/listinfo/python-list
Re: IDLE home page?
On Wed, Oct 22, 2008 at 3:49 AM, Terry Reedy <[EMAIL PROTECTED]> wrote: > Depending on the answer you get here, you might send the same observation > and question to [EMAIL PROTECTED] OK, I've just sent it. Thank you. -- http://mail.python.org/mailman/listinfo/python-list
doctest + shelve question
Hello list,
I have a question. I'm writing a simple object serialization module
using shelve to write arbitrary objects to a file (M.py). Now I have the
problem, that if I create a simple object in the doctest documentation
file M.txt like this:
>>> class tdata(object):
... def __init__(self, name):
... self.name = name
>>> tinst = tdata(u'foo')
and then run it with my module M:
>>> import M
>>> foo = M.serialize('/tmp/foo', tinst.name, tinst)
which calls:
class serialize(object):
def __init__(self, path, key, data):
db = shelve.open(path)
db[key.encode('utf-8')] = data
db.close()
then I get the following problem:
Failed example:
foo = M.serialize('/tmp/foo', tinst)
Exception raised:
Traceback (most recent call last):
File "/usr/lib/python2.5/doctest.py", line 1228, in __run
compileflags, 1) in test.globs
...
File "/usr/lib/python2.5/shelve.py", line 123, in __setitem__
p.dump(value)
PicklingError: Can't pickle : attribute lookup
__builtin__.tdata failed
If I do the same in the interactive interpreter, then it works fine.
Now, as I want to test an arbitrary data class, the doctest file is the
place to put the simple tdata class, but as far as I traced the problem,
it uses it's own namespace or something, and so does not work.
I'd like to keep a consistent doctest documentation here and not spawn
my project with additional test modules or similar.
Any idea on how I can make it work like as if it would be called from
the interactive interpreter? The documentation and Google were not too
helpful.
ps. Sys: Linux, Python: 2.5.2
thanks
--
Sebastian Bartos,
keyserevr: pgp.mit.edu
signature.asc
Description: This is a digitally signed message part
--
http://mail.python.org/mailman/listinfo/python-list
Re: Does Python have certificate?
On Mon, Mar 23, 2009 at 9:15 PM, Muddy Coder wrote: > I wonder that does Python have certificate? You see, java, .NET, PHP, > and so on, they have certificates for developers to get. Python is > quite popular nowadays, I wonder is there such a thing? If so, I > certainly want to get one. I searched, and No, there is no certification for Python. Maybe in the future... -- http://mail.python.org/mailman/listinfo/python-list
Re: Automatically generating arithmetic operations for a subclass
> I have a subclass of int where I want all the standard arithmetic > operators to return my subclass, but with no other differences: > > class MyInt(int): > def __add__(self, other): > return self.__class__(super(MyInt, self).__add__(other)) > # and so on for __mul__, __sub__, etc. > > > My quick-and-dirty count of the __magic__ methods that need to be over- > ridden comes to about 30. That's a fair chunk of unexciting boilerplate. > > Is there a trick or Pythonic idiom to make arithmetic operations on a > class return the same type, without having to manually specify each > method? I'm using Python 2.5, so anything related to ABCs are not an > option. > > Does anyone have any suggestions? Metaclasses can be used for this purpuse, see the example for a Roman number type [1] [1] http://paste.pocoo.org/show/97258/ -- Freedom is always the freedom of dissenters. (Rosa Luxemburg) -- http://mail.python.org/mailman/listinfo/python-list
Re: pyqt4 qTableWidget add items help
-BEGIN PGP SIGNED MESSAGE- Hash: SHA1 [...] > I've been trying > > while(len(orders)> i): > ui.tb1_tblOrders.setCurrentCell(i,0,orders[i][1]) > i+=1 > > which to me, says go add in the first column row with the first order, > and it makes sense to me Read the documentation [1] to learn, what ".setCurrentCell()" actually does and what its arguments are! And please stop this wild guessing ... The method you're searching for is ".setItem()" [2], which adds a new QTableWidgetItem [3] to a QTableWidget. [1] http://doc.trolltech.com/4.5/qtablewidget.html#setCurrentCell [2] http://doc.trolltech.com/4.5/qtablewidget.html#setItem [3] http://doc.trolltech.com/4.5/qtablewidgetitem.html - -- Freedom is always the freedom of dissenters. (Rosa Luxemburg) -BEGIN PGP SIGNATURE- Version: GnuPG v2.0.11 (GNU/Linux) iEYEARECAAYFAknpr4sACgkQGV4vxEMMOxdnawCfTXO55EffBJMQ7h91RGtMIpZ/ hcYAoLQ9yF5u/hBgNRvqxGRlIy5lPDgb =Q6ef -END PGP SIGNATURE- -- http://mail.python.org/mailman/listinfo/python-list
