hello everyone,
Im trying to make a program that takes an archive from pdb (for instance this
link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY
after reading it I want it to save in a list only this part of the archive:
MGSSHHSSGLVPRGSHMASMTGGQQMGRGSMPAETNEYLSRFVEYMTGERKSRYTI
José Manuel Suárez Sierra wrote:
> hello everyone,
> Im trying to make a program that takes an archive from pdb (for instance
> this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY
>
> after reading it I want it to save in a list only this part of the
> archive:
>
> MGSSHHS
On 2/1/2017 1:37 AM, Christian Gollwitzer wrote:
Am 01.02.17 um 00:02 schrieb MRAB:
On 2017-01-31 22:34, Christian Gollwitzer wrote:
.!frame.!checkbutton
.!frame.!checkbutton2
.!frame2.!checkbutton
.!frame2.!checkbutton2
Perhaps someone who knows Tcl and tk can tell me, but I notice that in
El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez Sierra
escribió:
> hello everyone,
> Im trying to make a program that takes an archive from pdb (for instance this
> link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY
>
> after reading it I want it to save
José Manuel Suárez Sierra wrote:
> El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez
> Sierra escribió:
>> hello everyone,
>> Im trying to make a program that takes an archive from pdb (for instance
>> this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY
>
Hi,
I've came to a problem where I want to keep backwards and forwards
compatibility with an exception syntax. And I mean by backwards going
further down to Python 2.5.
I was pointed to this option from a stack overflow answer[1] that works
forward and backwards, I rewrite the solution here:
imp
# Give user the file requested
url = "http://superhost.gr/data/files/%s"; % realfile
user, password = 'user', 'passwd'
r = requests.get( url, auth = (user, password) ) # send auth unconditionally
r.raise_for_status()
==
How can i ASK the user for http auth data and stor
# Introduction
The Python Community will be represented during FOSDEM 2017 with the Python
Devrooms.
This year, we will have two devrooms, the first one for 150 people on Saturday
and the second one for 450 people on Sunday, it's really cool because we had
accepted 24 talks instead of 16.
Thi
Hi all,
I have a curious problem with Python exceptions.
The following code doesn't catch HttpError:
```
from server.libs.googleapiclient.errors import HttpError
[..]
try:
OAuth.backoffExec(request)
return True
except HttpError as e:
return e.resp.status == 404
Ivo Bellin Salarin wrote:
> Hi all,
>
> I have a curious problem with Python exceptions.
>
> The following code doesn't catch HttpError:
> ```
> from server.libs.googleapiclient.errors import HttpError
> [..]
> try:
> OAuth.backoffExec(request)
> return True
> except Http
I'm often hitting this problem, how does one find out what package to
install to provide what a give import needs?
Currently I'm modifying some code which has 'import gtk', I want to
migrate from Python 2 to Python 3 if I can but at the moment the
import fails in Python 3.
There are dozens of pac
On Wed, Feb 1, 2017 at 8:11 AM, Ivo Bellin Salarin
wrote:
> This code generates instead the messages:
> ```
> ERROR 47.135[bigquery.py.create_table:362] caught exception: HttpError,
> defined in server/libs/googleapiclient/errors.pyc. we are in
> /Users/nilleb/dev/gae-sample-project/app
> ERROR 47
On Wed, 01 Feb 2017 17:12:26 +, Chris Green wrote:
> I'm often hitting this problem, how does one find out what package to
> install to provide what a give import needs?
>
> Currently I'm modifying some code which has 'import gtk', I want to
> migrate from Python 2 to Python 3 if I can but at
On Wed, 1 Feb 2017 07:10:39 -0800 (PST), Νίκος Βέργος wrote:
> # Give user the file requested
> url = "http://superhost.gr/data/files/%s"; % realfile
>
> user, password = 'user', 'passwd'
>
> r = requests.get( url, auth = (user, password) ) # send auth unconditionally
> r.raise_for_status()
>==
Wildman wrote:
> On Wed, 01 Feb 2017 17:12:26 +, Chris Green wrote:
>
> > I'm often hitting this problem, how does one find out what package to
> > install to provide what a give import needs?
> >
> > Currently I'm modifying some code which has 'import gtk', I want to
> > migrate from Python
On Thu, Feb 2, 2017 at 2:10 AM, Νίκος Βέργος wrote:
> # Give user the file requested
> url = "http://superhost.gr/data/files/%s"; % realfile
>
> user, password = 'user', 'passwd'
>
> r = requests.get( url, auth = (user, password) ) # send auth unconditionally
> r.raise_for_status()
> =
I'm developing a C module with the help of SWIG. My library manages
objects with reference counting, much like Python, except that it's
deterministic: there's no GC. I'm using Python 3.5.2.
I create two Python objects like this:
bakery = Bakery()
bread = bakery.create_bread()
Behind the
On Wed, 01 Feb 2017 19:15:13 +, Chris Green wrote:
> Wildman wrote:
>> On Wed, 01 Feb 2017 17:12:26 +, Chris Green wrote:
>>
>> > I'm often hitting this problem, how does one find out what package to
>> > install to provide what a give import needs?
>> >
>> > Currently I'm modifying som
In Peter Pearson
writes:
> > How can i ASK the user for http auth data and store them isntead of
> > giving them to the script?
> Maybe like this?
> user = raw_input("User: ")
> password = raw_input("Password: ")
If it doesn't need to be interactive, you could require that the user
suppl
Τη Τετάρτη, 1 Φεβρουαρίου 2017 - 9:22:46 μ.μ. UTC+2, ο χρήστης Chris
> You should use the input() function (called raw_input() in Python 2)
> for a user name, and the getpass module for the password:
i have just tried:
# Give user the file requested
url = "http://superhost.gr/da
Τη Τετάρτη, 1 Φεβρουαρίου 2017 - 9:22:46 μ.μ. UTC+2, ο χρήστης Chris Angelico
έγραψε:
> You should use the input() function (called raw_input() in Python 2)
> for a user name, and the getpass module for the password:
I have just tried
===
# Give user the file
On 02/01/2017 01:51 PM, Νίκος Βέργος wrote:
> as well as input() for both user & pass combo but iam not getting in chrome
> the basic pop-up HTTP auth window.
>
> Any idea why?
What you're describing is not something you can do with an interactive
Python script. HTTP-level authentication is req
On 02/01/2017 01:03 PM, Wildman via Python-list wrote:
>
> It is the proper way. This page helps explain it.
>
> http://askubuntu.com/questions/784068/what-is-gi-repository-in-python
>
>> ... and doesn't it need an internet connection?
>
> No.
However the gi module provides access to GTK+3, a
Τη Τετάρτη, 1 Φεβρουαρίου 2017 - 11:41:28 μ.μ. UTC+2, ο χρήστης Michael Torrie
έγραψε:
> On 02/01/2017 01:51 PM, Νίκος Βέργος wrote:
> > as well as input() for both user & pass combo but iam not getting in chrome
> > the basic pop-up HTTP auth window.
> >
> > Any idea why?
>
> What you're descr
Wildman wrote:
> On Wed, 01 Feb 2017 19:15:13 +, Chris Green wrote:
>
> > Wildman wrote:
> >> On Wed, 01 Feb 2017 17:12:26 +, Chris Green wrote:
> >>
> >> > I'm often hitting this problem, how does one find out what package to
> >> > install to provide what a give import needs?
> >> >
On Wed, 01 Feb 2017 21:29:00 +, Chris Green wrote:
> Wildman wrote:
>> On Wed, 01 Feb 2017 19:15:13 +, Chris Green wrote:
>>
>> > Wildman wrote:
>> >> On Wed, 01 Feb 2017 17:12:26 +, Chris Green wrote:
>> >>
>> >> > I'm often hitting this problem, how does one find out what package
On 30/01/17 02:14, Steve D'Aprano wrote:
On Mon, 30 Jan 2017 10:52 am, Erik wrote:
It would be even better if it was "else if not break:" to make the
meaning clearer.
break is not the only way to exit the for loop
Fine - "else if not break or raise or return:", then ;) [that is not a
seriou
On Wed, Feb 1, 2017 at 2:51 PM, Νίκος Βέργος wrote:
> Τη Τετάρτη, 1 Φεβρουαρίου 2017 - 11:41:28 μ.μ. UTC+2, ο χρήστης Michael
> Torrie έγραψε:
>> On 02/01/2017 01:51 PM, Νίκος Βέργος wrote:
>> > as well as input() for both user & pass combo but iam not getting in
>> > chrome the basic pop-up HTT
Τη Πέμπτη, 2 Φεβρουαρίου 2017 - 1:51:52 π.μ. UTC+2, ο χρήστης Ian έγραψε:
> On Wed, Feb 1, 2017 at 2:51 PM, Νίκος Βέργος wrote:
> > Τη Τετάρτη, 1 Φεβρουαρίου 2017 - 11:41:28 μ.μ. UTC+2, ο χρήστης Michael
> > Torrie έγραψε:
> >> On 02/01/2017 01:51 PM, Νίκος Βέργος wrote:
> >> > as well as input()
On 01/02/17 23:20, Wildman via Python-list wrote:
On Wed, 01 Feb 2017 21:29:00 +, Chris Green wrote:
Wildman wrote:
On Wed, 01 Feb 2017 19:15:13 +, Chris Green wrote:
OK, no problem, but isn't it very non-portable?
I don't see why not. It should work on any system
that has Python3
On Tue, 31 Jan 2017 02:56 am, Grant Edwards wrote:
> On 2017-01-30, Terry Reedy wrote:
>> On 1/30/2017 8:58 AM, Peter Otten wrote:
>>> Jussi Piitulainen wrote:
>>
It doesn't seem to be documented.
>>>
>>> For functions with a C equivalent a look into the man page is usually
>>> helpful.
>>
>
# Give user the file requested
print('''http://superhost.gr/data/files/%s";>''' % realfile)
authuser = os.environ.get( 'REMOTE_USER', 'Άγνωστος' )
print( authuser )
Trying this, feels liek i'm almost there except t
On Sun, 29 Jan 2017 04:58 am, Chris Angelico wrote:
> On Sun, Jan 29, 2017 at 3:15 AM, Steve D'Aprano
> wrote:
>> On Sat, 28 Jan 2017 10:50 pm, Chris Angelico wrote:
>>
>>> On Sat, Jan 28, 2017 at 9:49 PM, Steve D'Aprano
>>> wrote:
The terminal size doesn't change just because I'm piping ou
On 02/01/2017 02:29 PM, Chris Green wrote:
> OK, thank you, what a strange way to do it.
Why is it strange? Essentially, python bindings for any GObject-based
library are now fully automatic via this gi module. No longer do we
need custom bindings for each component of a glib-based library. Thi
On Sat, 28 Jan 2017 11:53 pm, Peter Otten wrote:
[...]
>> I see that as "Hey look, we can fool shutil into returning
>> absolute garbage instead of the terminal size!"
>
> There are valid reasons for temporarily altering the number of columns,
> like writing to a file or preparing a code sample.
On Thu, Feb 2, 2017 at 12:24 PM, Steve D'Aprano
wrote:
etc, etc, etc, etc. It's
not a proxy for "being piped" - it's that when your output isn't going
to a terminal, asking "what is my terminal size" isn't particularly
productive.
>>>
>>> Then explain why os.get_terminal_size()
On Thu, Feb 2, 2017 at 10:49 AM, Erik wrote:
> Well, _logically_ there is a flag (in as much as it could be thought of like
> that to make it easy to understand - and in C, that's pretty much what you
> have to actually do unless you really want to use 'goto').
The last time I wanted a for-else i
On 2017-02-01 23:49, Erik wrote:
On 30/01/17 02:14, Steve D'Aprano wrote:
On Mon, 30 Jan 2017 10:52 am, Erik wrote:
It would be even better if it was "else if not break:" to make the
meaning clearer.
break is not the only way to exit the for loop
Fine - "else if not break or raise or return
On 02/02/17 02:05, MRAB wrote:
Both suggestions are a little long-winded. Couldn't we just abbreviate
them to "else:"? :-)
You are not wrong ;)
E.
--
https://mail.python.org/mailman/listinfo/python-list
On 02/02/17 01:41, Chris Angelico wrote:
On Thu, Feb 2, 2017 at 10:49 AM, Erik wrote:
Well, _logically_ there is a flag (in as much as it could be thought of like
that to make it easy to understand - and in C, that's pretty much what you
have to actually do unless you really want to use 'goto')
On Thursday, February 2, 2017 at 5:44:51 AM UTC+5:30, Erik wrote:
> On 01/02/17 23:20, Wildman via Python-list wrote:
> > On Wed, 01 Feb 2017 21:29:00 +, Chris Green wrote:
> >
> >> Wildman wrote:
> >>> On Wed, 01 Feb 2017 19:15:13 +, Chris Green wrote:
> >> OK, no problem, but isn't it ver
41 matches
Mail list logo