Re: doubt loading pages

2017-02-01 Thread Peter Otten
José Manuel Suárez Sierra wrote: > El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez > Sierra escribió: >> hello everyone, >> Im trying to make a program that takes an archive from pdb (for instance >> this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY >

Re: doubt loading pages

2017-02-01 Thread José Manuel Suárez Sierra
El miércoles, 1 de febrero de 2017, 11:55:11 (UTC+1), José Manuel Suárez Sierra escribió: > hello everyone, > Im trying to make a program that takes an archive from pdb (for instance this > link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY > > after reading it I want it to save

Re: doubt loading pages

2017-02-01 Thread Peter Otten
José Manuel Suárez Sierra wrote: > hello everyone, > Im trying to make a program that takes an archive from pdb (for instance > this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY > > after reading it I want it to save in a list only this part of the > archive: > > MGSSHHS

doubt loading pages

2017-02-01 Thread José Manuel Suárez Sierra
hello everyone, Im trying to make a program that takes an archive from pdb (for instance this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY after reading it I want it to save in a list only this part of the archive: MGSSHHSSGLVPRGSHMASMTGGQQMGRGSMPAETNEYLSRFVEYMTGERKSRYTI