Hello. Need some help here. I have a 4*4 cube. So the equation of the
cube becoming:
x + 4*y + 16*z
Now i want to rotate this cube 90 degrees anticlockwise( a right
rotation). How can i do that? The rotation must take place with the
axis of rotation b
On Jul 16, 6:20 pm, Craig Allen <[EMAIL PROTECTED]> wrote:
> Anyone have any comments? Is there anything wrong, evil, or ugly
> about using a module this way, or am I correct to think that actually,
> this is a common approach in python.
>
> Is it pythonic?
The one drawback to this is that it co
dear Diez:
I need step into c function in extending module(DLL) when debugging
the script. and I want Single-step debugging the extend module itself,
but python script Launched The whole process.
best regards
fang
--
http://mail.python.org/mailman/listinfo/python-list
Alis schrieb:
Hi
Is there any component-oriented (non-MVC) web framework available for
Python?
That is something like Apache Wicket, Tapestry or JSF, but I need it
to be in Python.
ToscaWidgets, can be used with any WSGI-compliant framework.
Diez
--
http://mail.python.org/mailman/listinfo/py
The trick to this one is that the html looks something like this:
american,
/browse/blue blue
,
/browse/brick brick
, brie, cheddar, cheshire,
/browse/churn churn
,
/browse/cottage cottage
,
/browse/cream cream
, dunlop,
and it goes on
My question is I want everything inside, the conten
[EMAIL PROTECTED] schrieb:
dear all:
I have searched the debug informations of many python's IDE, but I
cannot find the method about debuging the extend module written in
Visual studio 2008 on windows.
The wingIDE tell me that we can debug the extend module on linux, but
cannot on windows. and u
In message <[EMAIL PROTECTED]>, Sebastian "lunar" Wiesner
wrote:
> Relying on the destructor is *always* a bad idea, you should always
> close files explicitly!
There shouldn't be any problem with files opened read-only.
--
http://mail.python.org/mailman/listinfo/python-list
In message <[EMAIL PROTECTED]>, Cyril Bazin
wrote:
> But it seems, after many tests, that the script stops at the
> instruction : "c.execute(requete)"
What's the error message? This should be in Apache's error_log file.
--
http://mail.python.org/mailman/listinfo/python-list
On Jul 16, 7:16 am, Ben Sizer <[EMAIL PROTECTED]> wrote:
> Although the standard library in Python is great, there are
> undoubtedly some great packages available from 3rd parties, and I've
> encountered a few almost by accident. However, I don't know how a user
> would become aware of many of thes
In message
<[EMAIL PROTECTED]>, Keith
Hughitt wrote:
> I have a UTC date (e.g. 2008-07-11 00:00:00). I would like to create a
> UTC date ...
>>> import calendar
>>> calendar.timegm((2008, 7, 11, 0, 0, 0, 0, 0, -1))
1215734400
[EMAIL PROTECTED]> TZ=NZ date -d "00:00:00 01-Jan-1970Z +1215734400 s
In message
<[EMAIL PROTECTED]>, Craig
Allen wrote:
> ... the ideal is still that
>
> tl = TehLibrary() would always return the same object.
>> class TehLibrary(object) :
... @classmethod
... def __new__(self, cls) :
... return self
>>> s = TehLibrary()
>>> s == TehLibrary()
True
import sys
class Attribute(object):
"""
Common attributes and methods for custom types
"""
__slots__ = []
def __init__(self, name=None, type=None, range=(0,1)):
self.__name = name
self.__type = type
self.__range = range
#Read only attribute
On Thu, 17 Jul 2008 05:41:11 +0200, Stefan Scholl wrote:
> Fredrik Lundh <[EMAIL PROTECTED]> wrote:
>> Stefan Scholl wrote:
>>
>>> Django isn't ready.
>>
>> That's a remarkably ignorant statement.
>
> The 1.0 release will be in September.
So what? It's not the version number that matters but
Fredrik Lundh <[EMAIL PROTECTED]> wrote:
> Stefan Scholl wrote:
>
>> Django isn't ready.
>
> That's a remarkably ignorant statement.
The 1.0 release will be in September.
--
Web (en): http://www.no-spoon.de/ -*- Web (de): http://www.frell.de/
--
http://mail.python.org/mailman/listinfo/python-
On Jul 17, 8:20 am, Craig Allen <[EMAIL PROTECTED]> wrote:
> Is it pythonic?
You probably can't get anymore pythonic than something written by the
BDFL. In describing the use of __new__ in Unifying types and
classes in Python 2.2 he gives this recipe for a Singleton.
class Singleton(object):
Hi, I think I have already solved this problem while I am digging into the
installation sources.
I found this:
C:\Python25\Lib\site-packages\py2exe\samples\singlefile\gui\setup.py
# Requires wxPython. This sample demonstrates:
#
# - single file exe using wxPython as GUI.
from distutils.core im
Alexnb wrote:
Hello
I am sure most of you are familiar with py2exe. I am having a bit of a
problem. See the program has a few pictures involved and the .ico it uses
for the windows. However, the pictures are stored in the same directory as
the source, something like: C:\Docs and settings\me\My d
Phillip B Oldham wrote:
We're looking at the next phase of development for our webapp, and the
main focus will be to move the core from the app to a web service so
other systems can use the data we've gathered (we're thinking along
the lines of the XML API of Highrise from 37Signals).
Its possib
Ben Sizer wrote:
Although the standard library in Python is great, there are
undoubtedly some great packages available from 3rd parties, and I've
encountered a few almost by accident. However, I don't know how a user
would become aware of many of these. http://pypi.python.org/pypi/
presumably lis
Thank you , Mike.
"Mike Driscoll" <[EMAIL PROTECTED]>
??:[EMAIL PROTECTED]
On Jul 2, 8:40 pm, "Leo Lee" <[EMAIL PROTECTED]> wrote:
> I need a window's handle to be passed to external c++.
> Thanks in advance
Are you talking about a wxPython wx.Window object or an external
window handle? If th
Please take close look at the details of the two snapshots.
I need explanation and correcting this problem.
begin 666 after.png
MB5!.1PT*&@[EMAIL PROTECTED];0```#-" ,```#GL'7)`7-21T(`KLX<
MZ01G04U!``"[EMAIL PROTECTED]>B8``("[EMAIL PROTECTED]@``'4P
M``#J8 [EMAIL PROTECTED]/ ```P!03%1%
dear all:
I have searched the debug informations of many python's IDE, but I
cannot find the method about debuging the extend module written in
Visual studio 2008 on windows.
The wingIDE tell me that we can debug the extend module on linux, but
cannot on windows. and using wingdbstub.py we can emb
Fredrik Lundh wrote:
> Yeah, but what do you expect that garbage collection pass to result in?
Basically, I want to toss the objects before I close the service that they
depend on.
> PyGC_Collect() does exactly that, so if that doesn't solve your problem,
> the only way to fix is this is to go b
I don't intend to do much subclassing of this, but of course, I'd
rather not second guess the future and it's not hard to imagine we
will come to some point that we need to do just that. Thanks for the
ideas about repairing option one, which I'd given up, though the ideal
is still that
tl = TehLi
I will try to modify the wmi.py ,however I'm a novice.It will take a
long time. You can give it up temporarily. If you don't mind ,can you
tell me where needs modifying and how? Just unicode? Or Other?
--
http://mail.python.org/mailman/listinfo/python-list
On 7月17日, 上午3时20分, Tim Golden <[EMAIL PROTECTED]> wrote:
> patrol wrote:
> > On 7月17日, 上午12时16分, Tim Golden <[EMAIL PROTECTED]> wrote:
> >> Assuming that the error comes back in the sys.stdout encoding, the
> >> following version *should* work ok. I still haven't got a non-English set
> >> up to
Fredrik Lundh wrote:
> Do these objects have direct references to a resource that you're
> explicitly destroying from your C code?
and yes, if this is the problem, the correct solution is to create an
separate object type that's designed to manages the resource and act as
a proxy against it, a
Kyle Lanclos wrote:
The DECREF decrements the reference count, but does not immediately prompt
garbage collection when the reference count drops to zero; that garbage
collection does not appear to occur until I return from the particular C
function I am in the middle of executing.
Yeah, but wh
On Jul 16, 5:20 pm, Craig Allen <[EMAIL PROTECTED]> wrote:
> Hey, forgive me for just diving in, but I have a question I was
> thinking of asking on another list but it really is a general question
> so let me ask it here. It's about how to approach making singletons.
> Background: I've been progr
Prashant Saxena wrote:
import sys
class Float(float):
"""
Custom float datatype with addtional attributes.
"""
def __new__(self,
value=0.0, #default value
name='', # string
& nbsp; range=(0.0, 1.0) # tuple
Fredrik Lundh wrote:
> what magic do you expect the "manual garbage collection" to do here that
> the DECREF doesn't already do?
The DECREF decrements the reference count, but does not immediately prompt
garbage collection when the reference count drops to zero; that garbage
collection does not a
John Savage wrote:
I save posts from a midi music newsgroup, some are encoded with
yenc encoding. This gave me an opportunity to try out the decoders
in Python. The UU decoder works okay, but my YENC effort gives
results unexpected:
import yenc, sys
fd1=open(sys.argv[1],'r')
#y
Andreas Tawn wrote:
Terry Reedy wrote:
For loop variables continue after the loop exits. This is
intentional.
I never knew that and I can't find reference to it in the docs. Can you
help me with the reasons for it?
1. Python's reluctance to multiply scopes without necessity (as other
re
Kyle Lanclos wrote:
I want to modify the above sequence to manually prompt Python's garbage
collection routine(s) to take over (performance is not an issue here),
similar to the following:
Py_XDECREF (some_callback);
PyCollect_Garbage ();
closeService (some_service);
return;
Is that possible?
I've done a lot of web searching, a fair bit of C-source reading, and
quite a lot of miscellaneous head scratching, and I find that I am not
necessarily closer to an ideal solution.
I have a Python/C interface layer that essentially does the following:
Py_XDECREF (some_callback);
closeService (so
Peng Yu <[EMAIL PROTECTED]> writes:
> Perl has a command line help perldoc. I'm wondering if python has a
> similar help command.
The interactive interpreter has a "help" command, and a corresponding
"help" function which can be passed an object to display its
docstrings recursively and nicely-fo
Peng Yu wrote:
Perl has a command line help perldoc. I'm wondering if python has a
similar help command.
it's built into the interpreter, and Python tells you how to use it when
you start Python in interactive mode.
$ python
Python 2.5.1
Type "help", "copyright", "credits" or "license" for
Hi,
Perl has a command line help perldoc. I'm wondering if python has a
similar help command.
Thanks,
Peng
--
http://mail.python.org/mailman/listinfo/python-list
web2py (not to be confused with web.py although both of them are
excellent) comes with XMLRPC, XML, JSON and RSS API. You can find an
XMLRPC example here:
http://mdp.cti.depaul.edu/examples/default/examples#xmlrpc_examples
The web2py source (including the optional web based interface) fits
Other possibility, combining Dan and Fredrik's posts:
import zipfile
import os
zips = {
'c:/spare.zip': ['c:/spare/huge.fm3', 'c:/spare/huge.wk3'],
'c:/seekfacts.zip': ['c:/seekfacts/bookmark.html', 'c:/seekfacts/
index.htm', 'c:/seekfacts/seek.css', 'c:/seekfacts/seek.js']
};
def z
On Jul 16, 11:33 pm, John Savage <[EMAIL PROTECTED]> wrote:
> I save posts from a midi music newsgroup, some are encoded with
> yenc encoding. This gave me an opportunity to try out the decoders
> in Python. The UU decoder works okay, but my YENC effort gives
> results unexpected:
>
> import ye
Hey, forgive me for just diving in, but I have a question I was
thinking of asking on another list but it really is a general question
so let me ask it here. It's about how to approach making singletons.
Background: I've been programming in python seriously for about a year
now, maybe a little lon
On Jul 15, 4:28 pm, "Joel Koltner" <[EMAIL PROTECTED]>
wrote:
> "Sion Arrowsmith" <[EMAIL PROTECTED]> wrote in message
>
> news:[EMAIL PROTECTED]
>
> > What's wrong with sys.argv ?
>
> Mainly that it doesn't exist. :-) The example was slightly contrived -- I'm
> really dealing with commands inter
On Jul 16, 4:42 pm, Whyatt <[EMAIL PROTECTED]> wrote:
> Hi all,
>
> I'm trying to create a message using SMTP Mail through Python with a
> message Importance of either 0 (Low) or 2 (High).
>
> If I do outer.Add_header('Importance', '0') it is ignored.
>
> If I do uter.Replace_header('Importance', '
Okay, what I want to do with this code is to got to thesaurus.reference.com
and then search for a word and get the syns for it. Now, I can get the syns,
but they are still in html form and some are hyperlinks. But I can't get the
contents out. I am not that familiar with BeautifulSoup. So if anyon
On Jul 16, 3:22 pm, Alexnb <[EMAIL PROTECTED]> wrote:
> Alexnb wrote:
>
> > Mike Driscoll wrote:
>
> >> On Jul 16, 1:37 pm, Alexnb <[EMAIL PROTECTED]> wrote:
> >>> Hello
>
> >>> I am sure most of you are familiar with py2exe. I am having a bit of a
> >>> problem. See the program has a few pictures
John S wrote:
> Not sure why you picked \A and \Z -- they are only useful if you are
> using the re.M flag.
Well, they're aliases for ^ and $ in "normal" mode, at least for strings
that don't end with a newline.
re.I is the same as re.IGNORECASE. More than one option may be OR'ed
together. T
On Jul 16, 9:38 am, Peng Yu <[EMAIL PROTECTED]> wrote:
> On Jul 15, 10:29 pm, Gary Herron <[EMAIL PROTECTED]> wrote:
>
>
>
> > Peng Yu wrote:
> > > Hi,
>
> > > The following code snippet is from /usr/bin/rpl. I would like the it
> > > to match a word, for example, "abc" in ":abc:". But the current
Alis <[EMAIL PROTECTED]>:
> Is there any component-oriented (non-MVC) web framework available for
> Python?
>
> That is something like Apache Wicket, Tapestry or JSF, but I need it
> to be in Python.
Zope [1] might be worth trying.
[1] http://www.zope.org
--
Freedom is always the freedom of d
[EMAIL PROTECTED] wrote:
This script uses a simple for loop to zip some files. However I am
repeating code that cries out for a nested loop.
Cries out for a *function*, I'd say.
My two lists of files_to_be_zipped (spare and seekfacts) are of
> uneven length so I can't seem to decipher the "
Alexnb wrote:
>
>
>
> Mike Driscoll wrote:
>>
>> On Jul 16, 1:37 pm, Alexnb <[EMAIL PROTECTED]> wrote:
>>> Hello
>>>
>>> I am sure most of you are familiar with py2exe. I am having a bit of a
>>> problem. See the program has a few pictures involved and the .ico it
>>> uses
>>> for the window
Mike Driscoll wrote:
>
> On Jul 16, 1:37 pm, Alexnb <[EMAIL PROTECTED]> wrote:
>> Hello
>>
>> I am sure most of you are familiar with py2exe. I am having a bit of a
>> problem. See the program has a few pictures involved and the .ico it uses
>> for the windows. However, the pictures are stored
On Jul 16, 2:11 pm, KDawg44 <[EMAIL PROTECTED]> wrote:
> Hi,
>
> We have a Lotus Notes Database that tracks time spent on projects.
> What I would like to do is develop a Time Tracker in Python that
> communicates with the server. This would pull projects in and allow a
> use to start a timer as h
On Jul 16, 1:37 pm, Alexnb <[EMAIL PROTECTED]> wrote:
> Hello
>
> I am sure most of you are familiar with py2exe. I am having a bit of a
> problem. See the program has a few pictures involved and the .ico it uses
> for the windows. However, the pictures are stored in the same directory as
> the sou
patrol wrote:
> On 7月17日, 上午12时16分, Tim Golden <[EMAIL PROTECTED]> wrote:
>> Assuming that the error comes back in the sys.stdout encoding, the following
>> version *should* work ok. I still haven't got a non-English set up to test
>> it on, but it certainly does return a Unicode error message.
>
Hi,
We have a Lotus Notes Database that tracks time spent on projects.
What I would like to do is develop a Time Tracker in Python that
communicates with the server. This would pull projects in and allow a
use to start a timer as he/she works on a given project. The user
would then be able to co
>I don't think RESTful interfaces are built in but I know people have
>succesfully built RESTful apps on top of CherryPy. Also plans >for REST in
>CherryPy 3 look promising. Here is a post I ran across from one of the
>contributers.
>"Hey there,
>CherryPy 3 is currently under brainstorming bef
>What we *do* need is a lightweight, simple framework that will allow
>us to create a RESTful interface and throw code together fast. We'll
>probably go with SQLObject (unless we can extract the ORM from django
>- lazy evaluation would be very useful), and we're just looking for
>something fast and
Phillip B Oldham wrote:
> So, can anyone suggest a lightweight python framework which just does
> the essentials?
web.py is pretty slim (not to be confused with web2py).
Pylons isn't very large, depending on what you call "essential."
j
--
http://mail.python.org/mailman/listinfo/python-list
Hello
I am sure most of you are familiar with py2exe. I am having a bit of a
problem. See the program has a few pictures involved and the .ico it uses
for the windows. However, the pictures are stored in the same directory as
the source, something like: C:\Docs and settings\me\My docs\python\prog
Fredrik Lundh wrote:
> Joshua Kugler wrote:
>
>> Experimenting has shown me that re.findall() will return a list with the
>> matches in the order it found them.
>
> "in the order it found them" doesn't really say much, does it? ;-)
>
> "findall" and "finditer" both scans the string from left to
Fredrik Lundh wrote:
>
> Alexnb wrote:
>
>> e = ''
>
>> try:
>> ...
>> except HTTPError, e:
>> print e.code
>> except URLError, e:
>> print e.reason
>>
>> if e == '':
>> print "good to go"
>
> footnote: here's a better way to test if an exception was raised or not:
>
>
On Wed, 16 Jul 2008 15:20:23 +0200, Fredrik Lundh wrote:
[snip]
> Hope this helps more than it confuses.
Absolutely. It is wonderfully enlightening. Many thanks.
--
To email me, substitute nowhere->spamcop, invalid->net.
--
http://mail.python.org/mailman/listinfo/python-list
On Jul 16, 6:48 pm, Alis <[EMAIL PROTECTED]> wrote:
> Hi
>
> Is there any component-oriented (non-MVC) web framework available for
> Python?
>
> That is something like Apache Wicket, Tapestry or JSF, but I need it
> to be in Python.
>
> Regards,
> Ali
Have you looked at kamaelia?
http://kamaelia.
Thanks Gabriel!
That helps clear things up for me. The above method works very well. I
only have one remaining question:
How can I pass a datetime object to MySQL?'
So far, what I've been doing is building the query as a string, for
example:
query = "INSERT INTO image VALUES(%d, %d, %s, '%s')" %
On Jul 16, 1:42 pm, [EMAIL PROTECTED] wrote:
> This script uses a simple for loop to zip some files. However I am
> repeating code that cries out for a nested loop. My two lists of
> files_to_be_zipped (spare and seekfacts) are of uneven length so I
> can't seem to decipher the "for_logic". I would
Hi All,
Let me start by saying that's I'm relatively new to Python, so please
be gentle!
I need to up upload a file to a Tomcat web app using httplib. The web
app requires the following:
Files need to be split into 100kb (102400b) and each file segment
loaded using the PUT request. It is also a r
Hi
Is there any component-oriented (non-MVC) web framework available for
Python?
That is something like Apache Wicket, Tapestry or JSF, but I need it
to be in Python.
Regards,
Ali
--
http://mail.python.org/mailman/listinfo/python-list
patrol wrote:
import wmi
wmi.WMI('non-existent computer')
> Traceback (most recent call last):
> File "", line 1, in
> File "C:\Python25\lib\wmi.py", line 1199, in connect
> handle_com_error (error_info)
> File "C:\Python25\lib\wmi.py", line 184, in handle_com_error
> excep
This script uses a simple for loop to zip some files. However I am
repeating code that cries out for a nested loop. My two lists of
files_to_be_zipped (spare and seekfacts) are of uneven length so I
can't seem to decipher the "for_logic". I would appreciate any help.
Thanks, Bill
import zipfile
im
On Jul 16, 12:28 pm, norseman <[EMAIL PROTECTED]> wrote:
> Ty hensons wrote:
>
> > how can i save my command prompt screen?
>
> ==
>
> That by itself leaves lots of questions. Taken literally to be the
> "box" then:
>
> In Microsoft use the "Print Scree
Ty hensons wrote:
> how can i save my command prompt screen?
==
That by itself leaves lots of questions. Taken literally to be the
"box" then:
In Microsoft use the "Print Screen" followed by mspaint and Edit/paste
(Or SHIFT-PrintScreen if whole
> > I need to know if I'm running on 32bit or 64bit ... so far I haven't
> > come up with how to get this info via python. sys.platform returns
> > what python was built on ... but not what the current system is.
> >
> > I thought platform.uname() or just platform.processor() would have
> > done
Ben Sizer wrote:
I'd love to have some way of finding out what hidden gems are out
there in the Python world
If they were easy to find, they wouldn't be "hidden gems". :-)
Dennis Cote
--
http://mail.python.org/mailman/listinfo/python-list
On 7月17日, 上午12时16分, Tim Golden <[EMAIL PROTECTED]> wrote:
> Assuming that the error comes back in the sys.stdout encoding, the following
> version *should* work ok. I still haven't got a non-English set up to test it
> on, but it certainly does return a Unicode error message.
>
> http://timgolden
On 7月16日, 下午11时59分, Tim Golden <[EMAIL PROTECTED]> wrote:
> patrol wrote:
> > -2147023174
> > 'RPC \xb7\xfe\xce\xf1\xc6\xf7\xb2\xbb\xbf\xc9\xd3\xc3\xa1\xa3'
> > None
> > None
>
> > --
> > import pythoncom
> > import win32com.client
Peng Yu wrote:
I didn't read the docs and tried the following code.
regex = re.compile(r"\A" + re.escape(old_str) + r"\Z",
opts.ignore_case and re.I or 0)
But I'm not sure why it is not working.
as the documentation says, \A and \Z matches at the beginning/end of a
*string*, not a word.
We're looking at the next phase of development for our webapp, and the
main focus will be to move the core from the app to a web service so
other systems can use the data we've gathered (we're thinking along
the lines of the XML API of Highrise from 37Signals).
Its possible that we'll extend the s
On Jul 15, 10:29 pm, Gary Herron <[EMAIL PROTECTED]> wrote:
> Peng Yu wrote:
> > Hi,
>
> > The following code snippet is from /usr/bin/rpl. I would like the it
> > to match a word, for example, "abc" in ":abc:". But the current one
> > would not match "abc" in ":abc:". I tried to modify it myself.
I have a small project for further development
in eclipse, using the pyDev plug-in.
I am working on foo.py and bar.pyc is also
in the directory.
bar.py is not in the directory; it is someone
else's (confidential) file, and I don't get
the python source.
Can I run bar.pyc from eclipse ?
--
http:
Assuming that the error comes back in the sys.stdout encoding, the following
version *should* work ok. I still haven't got a non-English set up to test it
on, but it certainly does return a Unicode error message.
http://timgolden.me.uk/wmi-project/wmi.py
The usual test case, if you wouldn't min
On Jul 16, 4:14 pm, Fredrik Lundh <[EMAIL PROTECTED]> wrote:
> Beema shafreen wrote:
> > How do I write a regular expression for this kind of sequences
>
> > >gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
> > MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
>
Hello,
I have an python application which I've been developing for several years (off
and on, mostly off for lack of time) which I'm considering putting up to open
source if I can find other developers interested in contributing.
The application is a web publisher/information outliner. (See an
patrol wrote:
> -2147023174
> 'RPC \xb7\xfe\xce\xf1\xc6\xf7\xb2\xbb\xbf\xc9\xd3\xc3\xa1\xa3'
> None
> None
>
> --
> import pythoncom
> import win32com.client
>
>
> try:
> win32com.client.GetObject ("winmgmts://blahblah")
> exc
On 7月16日, 下午10时39分, Tim Golden <[EMAIL PROTECTED]> wrote:
> patrol wrote:
> > The errors are in the following:
>
> > Traceback (most recent call last):
> > File "D:\My Documents\code\python\wmi\test.py", line 5, in
> > c = wmi.WMI ("non-existent computer")
> > File "C:\Python25\lib\wmi.py"
Hi all,
I'm trying to create a message using SMTP Mail through Python with a
message Importance of either 0 (Low) or 2 (High).
If I do outer.Add_header('Importance', '0') it is ignored.
If I do uter.Replace_header('Importance', '0') I get the error below.
Traceback (most recent call last):
Fil
Thanks to all for your time and patience with this!
The insert is working fine based on the suggestions in this thread.
I now have another problem that should be resolved with a regular
expression to remove currency formatting before inserting into the db.
--
http://mail.python.org/mailman/listinf
On Jul 16, 11:16 am, Gary Herron <[EMAIL PROTECTED]> wrote:
> Keith Hughitt wrote:
> > Hi all,
>
> > I am using someone else's script which expects input in the form of:
>
> > ./script.py arg2
>
> > I was wondering if the angle-brackets here have a special meaning? It
> > seems like
> > they
Hi all
I wrote a multithreaded script that polls mails from several pop/imap
accounts. To fetch the messages I'm using the getmail classes (
http://pyropus.ca/software/getmail/ ) , those classes use the poplib for
the real pop transaction.
When I run my script for a few hours cpu usage goes
Keith Hughitt wrote:
Hi all,
I am using someone else's script which expects input in the form of:
./script.py arg2
I was wondering if the angle-brackets here have a special meaning? It
seems like
they specify an input and output stream to use in place of the
console. I could not
find any
Keith Hughitt wrote:
I am using someone else's script which expects input in the form of:
./script.py arg2
is a common notation for "replace with argument value", so it
could be that they're just expecting you to type:
./script.py arg1 arg2
Alternatively, they meant
./scri
On Wed, 16 Jul 2008 07:53:56 -0700, Keith Hughitt wrote:
> I am using someone else's script which expects input in the form of:
>
> ./script.py arg2
>
> I was wondering if the angle-brackets here have a special meaning? It
> seems like they specify an input and output stream to use in plac
import sys
class Float(float):
"""
Custom float datatype with addtional attributes.
"""
def __new__(self,
value=0.0, #default value
name='', # string
range=(0.0, 1.0) # tuple
)
Hi all,
I am using someone else's script which expects input in the form of:
./script.py arg2
I was wondering if the angle-brackets here have a special meaning? It
seems like
they specify an input and output stream to use in place of the
console. I could not
find anything in the python man
On Wed, 16 Jul 2008 12:38:50 +0100, Robert Rawlins wrote:
> So, am I right to assume that python will still handle its garbage disposal
> if I implement __del__(), it just handles circular references in a slightly
> different way, but to the same effect. Right?
No. Circular references in objects
patrol wrote:
> The errors are in the following:
>
> Traceback (most recent call last):
> File "D:\My Documents\code\python\wmi\test.py", line 5, in
> c = wmi.WMI ("non-existent computer")
> File "C:\Python25\lib\wmi.py", line 1199, in connect
> handle_com_error (error_info)
> File
Ben Sizer wrote:
make my development a lot easier.
Knowing what kind of development you do might help, of course. Some
libraries are excellent in some contexts and suck badly in others...
Looking at things that larger projects and distributions use can also be
a good idea. For example, i
On 16 Jul., 15:38, Vinay Sajip <[EMAIL PROTECTED]> wrote:
> On Jul 16, 8:55 am, McA <[EMAIL PROTECTED]> wrote:
>
> > messages tologging.getLogger('tree.leave') would also show up
> > inlogging.getLogger('tree') automatically?
>
> Yes.
Ok.
>
> > Hope not to bother.
>
> Use the propagate flag, whi
Although the standard library in Python is great, there are
undoubtedly some great packages available from 3rd parties, and I've
encountered a few almost by accident. However, I don't know how a user
would become aware of many of these. http://pypi.python.org/pypi/
presumably lists most of the dece
Beema shafreen wrote:
How do I write a regular expression for this kind of sequences
>gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
line.split("|") ?
it's a bit hard to come up with a working RE with only
1 - 100 of 150 matches
Mail list logo
