Use double quotes ( " ) for surrounding, instead of apostrophy ( ' ). Thus it will interpret it and not translate it litterally.
-- Best Wishes, Yasen Petrov ICQ 163 671 835 "James Campbell" <[EMAIL PROTECTED]> wrote in message [EMAIL PROTECTED]">news:[EMAIL PROTECTED]... > Hi Everyone > > I'm having a spot of bother with a query string. > > The program below attempts to mimic a web form. It should post the value of > 'QUERY ..' to the cgi in $location. > > What is actually happening is that 'QUERY ..' itself is being sent as the > value. I copied the name 'QUERY ..' from the textarea name on the original > web form. > > I have tried character escaping the space and the two dots but that didn't > work (the cgi hung). > Maybe I need to use CGI.pm to generate the query string? > Anyone got any ideas? > Thanks > James > > ---------------------- > > #!/usr/bin/perl -w > use strict; > use LWP::UserAgent; > use HTTP::Request; > > #This is the sequence for analysis (it is actually all on one line!!!) > my Seq='MQMRVLRIQHPLDHRPRHDRKTRHEVMLPDRKTRDLVVAIRNDRRA > LRIGAHIQAMPVFRRVQIERRRGVRRMHVADALLNQLRGLRMQFQRHAERGRR > ALTRVVVRRGADAARGEHDVSRGERAPQRRRDALGVVADVLRPAERQPTRAEQ > FDNLRQMLVDPPARQDLIADDDDAKCHCRLFRLVSNSSVGNRRRVPHAAVLFR > AHALQRAQTV'; > > #Send the request > my $location = "http://www.sbc.su.se/~miklos/DAS/tmdas.cgi";; > my $agent = new LWP::UserAgent; > my $req = new HTTP::Request POST => "$location"; > $req -> header('Accept' => 'text/html'); > $req -> header('Accept' => 'image/gif'); > $req -> header('Accept' => 'text/plain'); > $req -> header('Content-Type' => 'application/x-www-form-urlencoded'); > $req -> content('QUERY ..' => $seq); > > > #Receive the response > my $result = $agent->request( $req ); > print $result->headers_as_string; > print $result->content; > > > > > > James Campbell > Tel: +44-(0)207-848-5111 > Email: [EMAIL PROTECTED] > =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= > > 'Where shall I begin, please your Majesty?' He asked > 'Begin at the beggining,' the King said gravely, 'and go on > till you come to the end: then stop.' > > Lewis Carroll, Alice's Adventures in Wonderland. > -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]
