Hi Everyone I'm having a spot of bother with a query string.
The program below attempts to mimic a web form. It should post the value of 'QUERY ..' to the cgi in $location. What is actually happening is that 'QUERY ..' itself is being sent as the value. I copied the name 'QUERY ..' from the textarea name on the original web form. I have tried character escaping the space and the two dots but that didn't work (the cgi hung). Maybe I need to use CGI.pm to generate the query string? Anyone got any ideas? Thanks James ---------------------- #!/usr/bin/perl -w use strict; use LWP::UserAgent; use HTTP::Request; #This is the sequence for analysis (it is actually all on one line!!!) my Seq='MQMRVLRIQHPLDHRPRHDRKTRHEVMLPDRKTRDLVVAIRNDRRA LRIGAHIQAMPVFRRVQIERRRGVRRMHVADALLNQLRGLRMQFQRHAERGRR ALTRVVVRRGADAARGEHDVSRGERAPQRRRDALGVVADVLRPAERQPTRAEQ FDNLRQMLVDPPARQDLIADDDDAKCHCRLFRLVSNSSVGNRRRVPHAAVLFR AHALQRAQTV'; #Send the request my $location = "http://www.sbc.su.se/~miklos/DAS/tmdas.cgi"; my $agent = new LWP::UserAgent; my $req = new HTTP::Request POST => "$location"; $req -> header('Accept' => 'text/html'); $req -> header('Accept' => 'image/gif'); $req -> header('Accept' => 'text/plain'); $req -> header('Content-Type' => 'application/x-www-form-urlencoded'); $req -> content('QUERY ..' => $seq); #Receive the response my $result = $agent->request( $req ); print $result->headers_as_string; print $result->content; James Campbell Tel: +44-(0)207-848-5111 Email: [EMAIL PROTECTED] =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= 'Where shall I begin, please your Majesty?' He asked 'Begin at the beggining,' the King said gravely, 'and go on till you come to the end: then stop.' Lewis Carroll, Alice's Adventures in Wonderland. -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED]