Snappy and lz4 do not have entropy encoders (
https://en.wikipedia.org/wiki/Entropy_encoding).  If your data is random
text they will not compress.  If your text is a string of all zeros or any
repeating pattern, it will compress significantly.  If its something like
JSON, or XML it will compress.

I suspect you either aren't using real world data, or haven't compared the
compression with different types of data (json?  web pages?   numbers?).
No compression test is of much use unless you specify _what_ you are trying
to compress and either construct a realistic corpus for your use case, or
test with a few well defined types of real data that might be similar to
your expected use case.

  Gzip and zstandard have entropy encoding (Huffman for gzip, and a
combination of Huffman and ANS for zstandard).  With these, even if your
text is purely random _text_, it will compress somewhat since text doesn't
use all 256 possible byte values and so it can use less than 8 bits per
character in the encoding.



On Wed, May 12, 2021, 22:35 Shantanu Deshmukh <shantanu...@gmail.com> wrote:

> I have some updates on this.
> I tried this on latest kafka 2.8. Ran my application. Results are same,
> snappy and lz4 dont seem to be working as uncompressed and compressed
> storage both measure the same.
>
> *I even tried kafka-producer-perf-test tool*. Below are the results
>
> Without any compression:
> ==========================>>
> sh bin/kafka-producer-perf-test.sh --num-records 100000 --throughput 10000
> --record-size 102400 --topic perf-test-uncompressed --producer-props
> *compression.type=none* bootstrap.servers=localhost:9092 --print-metrics
>
> 100000 records sent, *862.113558 records/sec (84.19 MB/sec)*, 376.08 ms avg
> latency, 1083.00 ms max latency, 371 ms 50th, 610 ms 95th, 778 ms 99th,
> 1061 ms 99.9th.
> ...
> producer-topic-metrics:*compression-rate*:{client-id=producer-1,
> topic=perf-test-uncompressed}   : *1.000*
>
> With snappy compression:
> ==========================>>
> sh bin/kafka-producer-perf-test.sh --num-records 100000 --throughput 10000
> --record-size 102400 --topic perf-test-uncompressed --producer-props
> *compression.type=snappy
> batch.size=100000 linger.ms <http://linger.ms>=5
> *bootstrap.servers=localhost:9092
> --print-metrics
>
> 100000 records sent, 599.905215 *records/sec (58.58 MB/sec)*, 540.79 ms avg
> latency, 1395.00 ms max latency, 521 ms 50th, 816 ms 95th, 1016 ms 99th,
> 1171 ms 99.9th.
> ...
> producer-topic-metrics:*compression-rate*:{client-id=producer-1,
> topic=perf-test-uncompressed}   : *1.001*
>
> <<======++++===============
> Above mentioned compression-rate didnt change even with
>
> With  Gzip compression
> *==========================>>*
> sh bin/kafka-producer-perf-test.sh --num-records 100000 --throughput 10000
> --record-size 102400 --topic perf-test-compressed --producer-props
> *compression.type=gzip* bootstrap.servers=localhost:9092 *batch.size=100000
> linger.ms <http://linger.ms>=5* --print-metrics
>
> 100000 records sent, *200.760078 records/sec (19.61 MB/sec)*, 1531.40 ms
> avg latency, 2744.00 ms max latency, 1514 ms 50th, 1897 ms 95th, 2123 ms
> 99th, 2610 ms 99.9th.
> ...
> producer-topic-metrics:*compression-rate*:{client-id=producer-1,
> topic=perf-test-compressed}   : *0.635*
>
> *<<============================*
>
> To summarise*:*
> compression type
> messages sent
> avg latency/throughput
> effective compression-rate
> none
> 100000
> 862.113558 records/sec (84.19 MB/sec)
> 1.000
> snappy
> 100000
> 599.905215 records/sec (58.58 MB/sec),
> 1.001
> gzip
> 100000
> 200.760078 records/sec (19.61 MB/sec)
> 0.635
>
> In short snappy = uncompressed !! Why is this happening?
>
> On Wed, May 12, 2021 at 11:40 AM Shantanu Deshmukh <shantanu...@gmail.com>
> wrote:
>
> > Hey Nitin,
> >
> > I have already done that. I used dump-log-segments option. And I can see
> > the codec used is snappy/gzip/lz4. My question is, only gzip is giving me
> > compression. Rest are equivalent to uncompressed storage,
> >
> > On Wed, May 12, 2021 at 11:16 AM nitin agarwal <nitingarg...@gmail.com>
> > wrote:
> >
> >> You can read the data from the disk and see compression type.
> >> https://thehoard.blog/how-kafkas-storage-internals-work-3a29b02e026
> >>
> >> Thanks,
> >> Nitin
> >>
> >> On Wed, May 12, 2021 at 11:10 AM Shantanu Deshmukh <
> shantanu...@gmail.com
> >> >
> >> wrote:
> >>
> >> > I am trying snappy compression on my producer. Here's my setup
> >> >
> >> > Kafka - 2.0.0
> >> > Spring-Kafka - 2.1.2
> >> >
> >> > Here's my producer config
> >> >
> >> > compressed producer ==========
> >> >
> >> > configProps.put( ProducerConfig.BOOTSTRAP_SERVERS_CONFIG,
> >> >             bootstrapServer);
> >> >     configProps.put(
> >> >             ProducerConfig.KEY_SERIALIZER_CLASS_CONFIG,
> >> >             StringSerializer.class);
> >> >     configProps.put(
> >> >             ProducerConfig.VALUE_SERIALIZER_CLASS_CONFIG,
> >> >             StringSerializer.class);
> >> >     configProps.put(ProducerConfig.COMPRESSION_TYPE_CONFIG, "snappy");
> >> >     configProps.put(ProducerConfig.LINGER_MS_CONFIG, 10);
> >> >
> >> > config of un-compressed producer ============
> >> >
> >> > configProps.put(
> >> >             ProducerConfig.BOOTSTRAP_SERVERS_CONFIG,
> >> >             bootstrapServer);
> >> >     configProps.put(
> >> >             ProducerConfig.KEY_SERIALIZER_CLASS_CONFIG,
> >> >             StringSerializer.class);
> >> >     configProps.put(
> >> >             ProducerConfig.VALUE_SERIALIZER_CLASS_CONFIG,
> >> >             StringSerializer.class);
> >> >
> >> > My payload is almost 1mb worth of string. After sending 1000
> compressed
> >> and
> >> > 1000 uncompressed such messages this is the result
> >> > =======================
> >> > [shantanu@oc0148610736 uncompressed-string-test-0]$ du -hsc
> >> > /data/compressed-string-test-0/*
> >> > 8.0K /data/compressed-string-test-0/00000000000000000000.index
> >> > 990M /data/compressed-string-test-0/00000000000000000000.log
> >> > 12K /data/compressed-string-test-0/00000000000000000000.timeindex
> >> > 4.0K /data/compressed-string-test-0/leader-epoch-checkpoint
> >> > 990M total
> >> >
> >> > [shantanu@oc0148610736 uncompressed-string-test-0]$ du -shc
> >> > /data/uncompressed-string-test-0/*
> >> > 8.0K    /data/uncompressed-string-test-0/00000000000000000000.index
> >> > 992M    /data/uncompressed-string-test-0/00000000000000000000.log
> >> > 12K /data/uncompressed-string-test-0/00000000000000000000.timeindex
> >> > 4.0K    /data/uncompressed-string-test-0/leader-epoch-checkpoint
> >> > 992M    total
> >> > =======================
> >> >
> >> > Here we can see the difference is merely 2MB. Is compression even
> >> working?
> >> > I used dump-log-segment tool
> >> > =======================
> >> > [shantanu@oc0148610736 kafka_2.11-2.0.0]$ sh bin/kafka-run-class.sh
> >> > kafka.tools.DumpLogSegments --files
> >> > /data/compressed-string-test-0/00000000000000000000.log
> >> --print-data-log |
> >> > head | grep compresscodec
> >> >
> >> > offset: 0 position: 0 CreateTime: 1620744081357 isvalid: true keysize:
> >> > -1 valuesize: 1039999 magic: 2 compresscodec: SNAPPY producerId: -1
> >> > producerEpoch: -1 sequence: -1 isTransactional: false headerKeys: []
> >> > payload:
> >> >
> >>
> klxhbpyxmcazvhekqnltuenwhsewjjfmctcqyrppellyfqglfnvhqctlfplslhpuulknsncbgzzndizwmlnelotcbniyprdgihdazwn
> >> > =======================
> >> >
> >> > I can see SNAPPY is mentioned as compression codec. But the difference
> >> > between compressed and uncompressed disk size is negligible.
> >> >
> >> > I tried gzip later on. And results are
> >> > =======================
> >> > [shantanu@oc0148610736 uncompressed-string-test-0]$ du -hsc
> >> > /data/compressed-string-test-0/*
> >> > 8.0K /data/compressed-string-test-0/00000000000000000000.index
> >> > 640M /data/compressed-string-test-0/00000000000000000000.log
> >> > 12K /data/compressed-string-test-0/00000000000000000000.timeindex
> >> > 4.0K /data/compressed-string-test-0/leader-epoch-checkpoint
> >> > 640M total
> >> > =======================
> >> >
> >> > So gzip seems to have worked somehow. I tried lz4 compression as well.
> >> > Results were same as that of snappy.
> >> >
> >> > Is snappy/lz4 compression really working here? Gzip seems to be
> working
> >> but
> >> > I have read a lot that snappy gives best CPU usage to compression
> ratio
> >> > balance. So we want to go ahead with snappy.
> >> >
> >> > Please help
> >> >
> >> > *Thanks & Regards,*
> >> > *Shantanu*
> >> >
> >>
> >
>

Reply via email to