Re: [Bioc-devel] ShortRead readFasta UniProt Incorrect Import

2017-10-18 Thread Hervé Pagès
Hi, I just modified the Sequence Data workflow to suggest the use of readDNAStringSet() and family to read in a FASTA file. Cheers, H. On 10/18/2017 08:03 AM, Martin Morgan wrote: On 10/18/2017 01:00 AM, Dario Strbenac wrote: Good day, If I have a FASTA file that contains sp|Q9NYW0|T2R10_H

Re: [Bioc-devel] ShortRead readFasta UniProt Incorrect Import

2017-10-18 Thread Martin Morgan
On 10/18/2017 01:00 AM, Dario Strbenac wrote: Good day, If I have a FASTA file that contains sp|Q9NYW0|T2R10_HUMAN Taste receptor type 2 member 10 OS=Homo sapiens GN=TAS2R10 PE=1 SV=3 MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI IITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYF