Hi,
I am quite new to this perl language-I am from biochemistry field.
Now trying to write a script for my current work but could not make it.
The idea is to calculate the composition (percentage) of amino acids in
a protein sequence.
Input is a series of fasta format (protein seque
On 2010-12-01 09:59, Shlomi Fish wrote:
Hi,
On Wednesday 01 December 2010 10:44:17 Changrong Ge wrote:
Hi,
I am quite new to this perl language-I am from biochemistry field.
Now trying to write a script for my current work but could not make it.
The idea is to calculate the
:17 Changrong Ge wrote:
Hi,
I am quite new to this perl language-I am from biochemistry field.
Now trying to write a script for my current work but could not make it.
The idea is to calculate the composition (percentage) of amino acids in
a protein sequence.
Input
>> LHDLMCQCWRRDPEERPTFEYLQAQLLPACVLEVAE
>>
>
> The regex solution uses the (??{CODE}) extended regular expression,
> explained in perlre[0]. The for solution uses split with an empty pattern,
> which splits on the empty string[1].
>
> [0] http://perldoc.perl.org/perlre.htm
S T W Y V);
>
> foreach my $k (keys %seq){
> my %count; # a hash to hold the count for each amino acid in the
> protein.
> my @seq= split(//, $seq{$k});
> foreach my $r(@seq){
> $count{$r}++;
> }
> print("$k\n");
> foreach my $a (@aa)