On Dec 1, 3:27 pm, shlo...@iglu.org.il (Shlomi Fish) wrote:
> Hi meaculpa,
>
> please reply to the list as I specifically requested in my signature.
>
> On Wednesday 01 December 2010 12:10:20 meaculpa wrote:
>
> > here what i am using is it fetch the class which is given from column
> > 11 and matc
No No, this is not an assignment and iam not a college student. I am a
professional and this is for automation using data driven. I have
experiencce in Ruby but not perl. Please help
--
To unsubscribe, e-mail: beginners-unsubscr...@perl.org
For additional commands, e-mail: beginners-h...@perl.or
> On Dec 1, 7:31 am, jwkr...@shaw.ca ("John W. Krahn") wrote:
>
> Correction:
>
> my @sorted_files_in_directory =
> map $_->[ 1 ],
> sort { $a->[ 0 ] <=> $b->[ 0 ] }
> map { ( stat "$directory_name/$_" )[ 9 ], $_ }
map { [ ( stat "$directory_name/$_" )[ 9 ], $_ ] }
>
here what i am using is it fetch the class which is given from column
11 and match with the age of students with column 12 and output the
name from column 5.
So how this code will make it work. Will be helpful if given a detaled
reply as I am new to perl and need to submit it by today.
--
To u
Dear, I have tried to purchase some products from a business company,
I have attracted by high quality products, low price and enthusiastic
services, I think if you are free, you can go to see: styleele.com
,picking your interesting. ~--.
--
To unsubscribe, e-mail: beginners-unsubscr...@perl.org
>
> Why are you returning the results of //g to an empty list, in void context?
Forcing list context; //g alone is scalar, which using that regex, it grabs
the first character, executes the code.. And that's it. As a list, it does
what it should do, so to say :)
If you are going to skip whitespac
Brian Fraser wrote:
...and before someone chastises me (rightly so) for using (??{CODE}) in a
situation where a perfectly good (?{CODE}) would've done just fine, or for
not skipping that first line, or using $1 instead of the more scalable $^N..
Here's a little preemptive redemption:
while () {
Brian Fraser wrote:
On Wed, Dec 1, 2010 at 4:58 PM, Mariano Loza Collwrote:
Alternatively, a good samaritan out there can gelp you with a one or
two-liner code.
If you only want to count letters, here's the 1-2 liner code, I guess:
#! /usr/bin/perl
use strict;
use warnings;
use 5.010;
my %let
...and before someone chastises me (rightly so) for using (??{CODE}) in a
situation where a perfectly good (?{CODE}) would've done just fine, or for
not skipping that first line, or using $1 instead of the more scalable $^N..
Here's a little preemptive redemption:
while () {
>next if /^>/;
>
Hi guys,
Thank you so much for the help and I really really appreciate what you
guys did for me.
I will definitely try all your suggestions plus those scripts.
Good to be here and also learn a lot by reading emails on perl
discussion.
Regards,
Changrong
On Wed, Dec 1, 201
On Wed, Dec 1, 2010 at 4:58 PM, Mariano Loza Coll wrote:
Alternatively, a good samaritan out there can gelp you with a one or
two-liner code.
If you only want to count letters, here's the 1-2 liner code, I guess:
> #! /usr/bin/perl
> use strict;
> use warnings;
> use 5.010;
>
> my %letter_count;
On 10-12-01 02:58 PM, Mariano Loza Coll wrote:
gi|61499|emb|CAA24495.1| src [Avian sarcoma virus]
MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKLFGGFNTSDTV
TSPQRAGALAGGVTTFVALYDYESWIETDLSFKKGERLQIVNNTEGNWWLAHSLTTGQTGYIPSNYVAPS
DSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKG
> here is the script. give it a name, say, seqComp.pl. usage: perl
seqComp.pl
> .
> HTH,
> Anjan
...And as I was writing my reply, Anjan the good samaritan came to the
rescue.
Thanks Anjan!
Mariano
Hello everyone,
I'm so glad that I could finally be of some help to a group that helped me
before.
> Hi Changrong
>
> The problem doesn't seem difficult, but I'm afraid we don't have much
> knowledge of bioinformatics between us. If you post a sample of input
> data and the corresponding output
here is the script. give it a name, say, seqComp.pl. usage: perl seqComp.pl
.
HTH,
Anjan
#! /usr/bin/perl -w
use strict;
open (S, "$ARGV[0]") || die "cannot open FASTA file to read: $!";
my %s;# a hash of arrays, to hold each line of sequence
my %seq; #a hash to hold the AA sequences.
my $key;
On 01/12/2010 08:44, Changrong Ge wrote:
I am quite new to this perl language-I am from biochemistry field.
Now trying to write a script for my current work but could not make
it. The idea is to calculate the composition (percentage) of amino
acids in a protein sequence.
Input is a series of fa
On Wednesday 01 December 2010 16:57:07 John W. Krahn wrote:
> Amit Saxena wrote:
> > Hi all,
> > {
> >
> > next if ( ( $filename eq "." ) or ( $filename eq ".." ) );
> >
> > push ( @files_in_directory, $filename );
> >
> > }
>
> Since all you are doing is populating t
On 10-12-01 09:57 AM, John W. Krahn wrote:
Or just:
print map( "$_\n", @files_in_directory ), "\n";
print map( "$_\n", @sorted_files_in_directory ), "\n";
--
Just my 0.0002 million dollars worth,
Shawn
Programming is as much about organization and communication
as it is about coding.
John W. Krahn wrote:
Amit Saxena wrote:
my @sorted_files_in_directory;
@sorted_files_in_directory = sort { (stat($a))[9]<=> (stat($b))[9] }
If you read the documentation for readdir you will see where it says:
If you're planning to filetest the return values out of a
"readdir", you'd better
Amit Saxena wrote:
Hi all,
Hello,
The following perl program, for sorting files in a directory, without using
any OS specific command, ordered by modified timestamp is not working.
Please help.
*Perl Program*
#!perl.exe
use strict;
use warnings;
my $directory_name;
print "This program pr
On 10-12-01 07:19 AM, Amit Saxena wrote:
print "Sorted listing of files in<$directory_name> directory are as follows
:-\n";
my $j;
foreach $j ( @files_in_directory )
foreach $j ( @sorted_files_in_directory )
{
print $j . "\n";
}
print "\n";
--
Just my 0.0002 million dollars w
On Tue, Nov 30, 2010 at 6:28 PM, David Christensen <
dpchr...@holgerdanske.com> wrote:
> Sooraj S wrote:
> > Can i redirect the output to a file as well as stdout at the same
> > time...i dont want to use tee command..i want this to be done in my
> > perl program itself...
>
> Jim Gibson wrote:
>
Hi all,
The following perl program, for sorting files in a directory, without using
any OS specific command, ordered by modified timestamp is not working.
Please help.
*Perl Program*
#!perl.exe
use strict;
use warnings;
my $directory_name;
print "This program print the files in ascending orde
Thanks for the codingstyle tips, Shlomi. I instantly changed that =)
@Rob: The structure of my data is like
category_a->index_a->value_a
category_a->index_b->value_b
category_a->category_b->index_a->value_a
So sometimes I have a category in a category, sometimes it is just a
value in a
Hi meaculpa,
please reply to the list as I specifically requested in my signature.
On Wednesday 01 December 2010 12:10:20 meaculpa wrote:
> here what i am using is it fetch the class which is given from column
> 11 and match with the age of students with column 12 and output the
> name from colu
On Wed, Dec 1, 2010 at 10:24 AM, Dennis Jakobi wrote:
> Hi there,
>
> I have the following problem:
>
> I want to read a logfile in which every line follows this rule:
> ::...
>
> But the number of values differs. Sometimes a line has 2 values (the
> minimum) and sometimes 3 or more values. Now I
Hi Dennis,
On Wednesday 01 December 2010 11:24:02 Dennis Jakobi wrote:
> Hi there,
>
> I have the following problem:
>
> I want to read a logfile in which every line follows this rule:
> ::...
>
> But the number of values differs. Sometimes a line has 2 values (the
> minimum) and sometimes 3 or
Hi meaculpa,
On Wednesday 01 December 2010 09:25:43 meaculpa wrote:
> I have a csv file, and iam checking for a condition like :
>
> if (@columns=parse_csv($_))
>{
> #print $columns[11]."__\n";
>
> if($columns[11] =~ m/$field/i && $columns[12] ge "$\rating" )
> {
> writeLog(
Hi there,
I have the following problem:
I want to read a logfile in which every line follows this rule:
::...
But the number of values differs. Sometimes a line has 2 values (the
minimum) and sometimes 3 or more values. Now I want to push these
values into a hash that follows that form:
$hash->{
I have a csv file, and iam checking for a condition like :
if (@columns=parse_csv($_))
{
#print $columns[11]."__\n";
if($columns[11] =~ m/$field/i && $columns[12] ge "$\rating" )
{
writeLog("Name: $columns[5] \n\t Rating: $columns[12]\n");
OpenCv($columns[5]);
Instead o
Tack så mycket,
I will check that website
The output is the percentage of each amino acid in the protein.
For example, protein A is 100 amino acid long, in which there are 10
lysine, then the output for lysine is 0.1, the same rule for the
other amino acids.
In t
Tack så mycket, I will check that website.
The values are the percentage of amino acids in the sequence.
For example, protein A is 100 amino acid long, in which there are 12
arginine, then output for arginine is 12%; for the other 19 amino acids,
it is the same rule.
Thanks anyway,
Changrong
Hi,
On Wednesday 01 December 2010 10:44:17 Changrong Ge wrote:
> Hi,
> I am quite new to this perl language-I am from biochemistry field.
> Now trying to write a script for my current work but could not make it.
> The idea is to calculate the composition (percentage) of amino acids in
Hi Ahswin,
On Wednesday 01 December 2010 10:43:39 ashwin ts wrote:
> hello,
>
> can some one please let me know about where i can find materials on perl
> MQSeries...
why are you unhappy from http://search.cpan.org/dist/MQSeries/ ?
Regards,
Shlomi Fish
--
Hi,
I am quite new to this perl language-I am from biochemistry field.
Now trying to write a script for my current work but could not make it.
The idea is to calculate the composition (percentage) of amino acids in
a protein sequence.
Input is a series of fasta format (protein seque
hello,
can some one please let me know about where i can find materials on perl
MQSeries...
Thanks in advance..
Regards
Ashwin Thayyullathil Surendran
#91 988732
36 matches
Mail list logo
