Hi, I wish to grab part of the CDS entry from
http://www.ncbi.nlm.nih.gov/nuccore/KF699528.2 namely, "MLDHSSVNSTIAPGNLLNLPVWCYLLETEEGPILVDTGMPESAV NNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAF TNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQ SLFIETEQSGSILLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVAKEKPIIF FGHDIEQEKGCKVFPEYIPRAE" I tried to view the source code, but it doesn't show this part, and when I used wget http://www.ncbi.nlm.nih.gov/nuccore/KF699528.2 the thing I grabbed also doesn't show this part. Because I have lots of things with different end part http://www.ncbi.nlm.nih.gov/nuccore/**** so it is going to be nice to know how to get these html plain file which contains these sequence, can anyone points out something to let me go further, Thanks, lina

