[I guess you responded in the wrong thread - but it is nice to know anyway.]
On Fri, Apr 08, 2016 at 03:34:03AM +0200, Steffen Möller wrote: > Hello, > > I have identified (some of the glitches) of the autodock tools and I > know upstream to already have worked on it, seriously. This is the pack > and grid on the same frame and incompatibility with the numeric library. > I'll send them a ping. > > Best, > > Steffen > > On 07/04/16 23:58, Canberk Koç wrote: > > Hello Andreas, > > > > Thanks for rapid response again i talk with my friend he will send an > > introduction email to list. In test issue i'm confused about something > > if i delete dh_make section and run adt-run package do automatic test > > in built time and give no erors i notice that now but can't figure it > > out why already and working on it. Also i make set -e in unit test > > file but that fatal eror strings wont exit and work through the end it > > is another abnormality i found so i want to give you a little update > > about it. > > And CC issue i do it right now i think :-) > > > > Best Regards > > > > Canberk > > > > 2016-04-07 9:32 GMT+03:00 Andreas Tille <[email protected] > > <mailto:[email protected]>>: > > > > Hi Canberk, > > > > On Thu, Apr 07, 2016 at 04:42:56AM +0300, Canberk Koç wrote: > > > >[I think I gave a warning that non-private messages will be > > answered on > > > >the mailing list and I hereby doing so shamelessly violating > > netiquette. > > > >It would be great if you would answer on list as well.] > > > > > > Sorry for miss clicking i forget to reply all. > > > > No problem. BTW, the mailing list policy for Debian list is to not CC > > the original poster but just send to the mailing list. The mail > > client > > mutt supports "list-reply" (L) to do this efficiently. I have no idea > > about other mail clients and whether these might support this. Just > > telling you that if you might write on other Debian lists people might > > send angry replies for personal CCs. :-) > > > > > I committed the changes to exonerate package i hope i do it right. > > > > Yes. You did. :-) I turned your "NMU" into a "Team upload". The > > test > > suite can implemented in this way. However, when I actually run the > > test I get: > > > > ... > > /tmp/exonerate-test.nhNsuB/util/fastasplit.test.sh > > <http://fastasplit.test.sh> > > Split fastasplit.test.fasta OK > > Split into two files as expected > > Input len 2136 > > Output len 2136 > > Input and output lengths match > > > > /tmp/exonerate-test.nhNsuB/util/fastadiff.test.sh > > <http://fastadiff.test.sh> > > fastadiff: id mismatch: CALM_HUMAN P53_HUMAN > > Different seqs recognised as different > > Identity test OK > > > > /tmp/exonerate-test.nhNsuB/util/fastasubseq.test.sh > > <http://fastasubseq.test.sh> > > Generated correct subseq > > > > /tmp/exonerate-test.nhNsuB/util/fastavalidcds.test.sh > > <http://fastavalidcds.test.sh> > > > > ** (process:7647): WARNING **: odd_length length (7) not divisible > > by 3 > > > > ** (process:7647): WARNING **: too_short length (4) not divisible by 3 > > > > ** (process:7647): WARNING **: no_start missing start codon (has:AAA) > > > > ** (process:7647): WARNING **: no_end missing stop codon (has:TTT) > > > > ** (process:7647): WARNING **: in_frame_stop contains in-frame > > stop codon (pos:9, codon:TAG) > > > > ** (process:7647): WARNING **: non_acgt_base contains non-ACGT > > base: [pos: 5 base: N] > > Validiated CDS sequences OK > > >valid_seq > > ATGAAACCCGGGTTTTAA > > Validated correctly a single seq from input > > > > /tmp/exonerate-test.nhNsuB/util/fastaindex.fastafetch.test.sh > > <http://fastaindex.fastafetch.test.sh> > > Made index fastafetch.test.idx > > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > > CALM_HUMAN > > expect 0 > > >CALM_HUMAN > > MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL > > TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE > > EFVQMMTAK > > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > > P53_HUMAN > > expect 0 > > >P53_HUMAN > > MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA > > PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT > > CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN > > TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGR > > DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL > > KDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD > > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > > A_MISSING_FROM_START > > expect 1 > > ** FATAL ERROR **: Could not find identifier > > [A_MISSING_FROM_START] (missing -F ?) > > exiting ... > > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > > M_MISSING_FROM_MIDDLE > > expect 1 > > ** FATAL ERROR **: Could not find identifier > > [M_MISSING_FROM_MIDDLE] (missing -F ?) > > exiting ... > > /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx > > z_MISSING_FROM_END > > expect 1 > > ** FATAL ERROR **: Could not find identifier [z_MISSING_FROM_END] > > (missing -F ?) > > exiting ... > > fastaindex fastafetch test OK > > > > /tmp/exonerate-test.nhNsuB/util/fastaremove.test.sh > > <http://fastaremove.test.sh> > > Have calmodulin in input > > ** FATAL ERROR **: Could not open list for removal [CALM_HUMAN] > > exiting ... > > Calmodulin successfully removed > > PASS > > > > > > These "FATAL ERROR" strings in connection with "PASS" do not sound > > convincing. I wonder whether the build time tests are different > > in this aspect. > > > > > > > In MoM issue i want to do it but my mid-term exams start and > > they'll finish > > > 25 April i can do it after that date. And i want to ask you one > > friend of > > > mine wants to work it on too can we work together in that project. > > > > We'd be happy about any volunteer contributing to the Debian Med > > project. > > > > Kind regards > > > > Andreas. > > > > -- > > http://fam-tille.de > > > > > > > > > > -- > > > > -- > > > > Canberk Koç > > https://about.me/canberkkoc > > > > <https://about.me/canberkkoc?promo=email_sig&utm_source=email_sig&utm_medium=email_sig&utm_campaign=external_links> > > > > -- http://fam-tille.de
