Sure, If i understand correctly,I am pasting a part of the file to give you a better idea of wat I am trying to do:
gene 410..1750 /gene="dnaA" /db_xref="EMBL:2632267" CDS 410..1750 /gene="dnaA" /function="initiation of chromosome replication (DNA synthesis)" /note="alternate gene name: dnaH, dnaJ, dnaK" /codon_start=1 /transl_table=11 /protein_id="CAB11777.1" /db_xref="GI:2632268" /translation="MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTIT APNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKED TSDFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHL MHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQF LAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPP DLETRIAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDIN ADLAAEALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMY LSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK" gene 1939..3106 /gene="dnaN" /db_xref="EMBL:2632267" CDS 1939..3075 /gene="dnaN" /EC_number="2.7.7.7" /function="DNA synthesis" /note="alternate gene name: dnaG, dnaK" /codon_start=1 /transl_table=11 /product="DNA polymerase III (beta subunit)" /protein_id="CAB11778.1" /db_xref="GI:2632269" /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSF TGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQY LTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRP ILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDN QELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAID RASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKY MLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY" On 12/4/07, Gunnar Hjalmarsson <[EMAIL PROTECTED]> wrote: > minky arora wrote: > > Got it.Thanks.I have been able to retrive all the info i need and in > > the format that I want. > > Would you mind letting us know about that format? Doing so might help us > help you with your next question... > > > I have range1..range1 > > range2..range2 > > > > The start of all the 2 range is same.The ending number is differnent.I > > need to compute the difference in the two and display it with the gene > > name: example for this snippet: > > > > dnaA:75 > > > > I need an idea as to how to tie the gene name with the diff. value. > > -- > Gunnar Hjalmarsson > Email: http://www.gunnar.cc/cgi-bin/contact.pl > > -- > To unsubscribe, e-mail: [EMAIL PROTECTED] > For additional commands, e-mail: [EMAIL PROTECTED] > http://learn.perl.org/ > > > -- To unsubscribe, e-mail: [EMAIL PROTECTED] For additional commands, e-mail: [EMAIL PROTECTED] http://learn.perl.org/